KEGG   Acinetobacter soli: BEN76_12985Help
Entry
BEN76_12985       CDS       T04684                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
asol  Acinetobacter soli
Pathway
asol00620  Pyruvate metabolism
asol00680  Methane metabolism
asol01100  Metabolic pathways
asol01120  Microbial metabolism in diverse environments
asol01200  Carbon metabolism
Module
asol_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:asol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BEN76_12985
  09102 Energy metabolism
   00680 Methane metabolism
    BEN76_12985
Enzymes [BR:asol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BEN76_12985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 FTA4
Motif
Other DBs
NCBI-ProteinID: APV36881
UniProt: A0A1P8EKY7
LinkDB All DBs
Position
2738941..2741625
Genome map
AA seq 894 aa AA seqDB search
MIQQIDAPLREDVRLLGNLLGETLKQHAGQDLFNQIEQIRALAKGARDGQAKVEKQLEKL
FLNLKDEEILPLTRAFSYFLNFANIAEQYHVVRSRRQSEFDAHAPSPNPLTRLFEKFQHN
HITPQQLFDQVCELNIELVLTAHPTEVSRRTLIQKYDDINDALSKLDQQKLTPQEREQVL
TNLKHLICSAWQTDEIRQNKPTPLDEAKWGFTTIEQTLWNAVPKFVRELNTLVHQHCNAT
LPLDISPIRFASWMGGDRDGNPNVTHTVTQEVLWLSRWQAADLYLRDIESLRWELSIQAC
SEELSLALGRSHPEPYREYLRTTRERLKATRHWLSLRLQGLDGDDSQIIRHKQELLEPLL
LCHRSLIACNLPELANGKLLDFIYRVNCFGIELLKLDIRQESGRHRQAISAITEYLGLGN
FESWTEQARQNFLIQELQSKRPLLPKYLKEPEGSLIEHPDVKEVFATMRTLAEQPPESLG
AYIISMAEYPSDVLAVLLLQKEAGILHPLRVVPLFETLKDLDGAAKTMETLFNMDWYKQH
IQGKHEVMIGYSDSAKDAGFMSANWAQYRAQEELTAVAKAHNVQLTLFHGRGGSISRGGA
PTQQALFSQPPGSISGAIRVTEQGEMIRFKFGLEGVALQNLEVYTAATLEATLLPPPVPK
AEWRELMHQMTDISVRVYRETVRENPHFVQYLRTVTPELELQMLPLGSRPAKRKVSGGIE
SLRAIPWVFAWTQIRLMLPAWLGTGAAINQVIDENKKPLLDEMLAEWPYFQTLIDMLEMV
LSKADANVALYYESHLTHDDELKVLGEMLRARLNDAVQTLLTMKGESKLLSKNDVLDQAM
QVRKPYLLPLHLLQAELMKRRREYTAKTNADHTPVDHALMVSIAGIAAGLRNTG
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgattcaacaaattgatgctccactgcgtgaggatgtacgcttactgggaaatttactg
ggcgaaacactcaaacaacacgcaggacaagatttgtttaatcagattgaacaaattcgt
gcactcgccaaaggtgcacgtgacggtcaagcgaaagttgaaaagcaattagaaaagtta
tttttaaatttaaaggacgaggaaatcttaccgctgacccgcgcgttttcctattttttg
aattttgccaatattgcagaacaataccatgtggttcgtagccgtcgtcaaagcgagttt
gatgcacatgccccttcaccgaatccactaactcgcctgtttgagaaatttcagcacaat
cacatcaccccgcaacaactatttgatcaggtatgcgagctgaatattgaactggtactg
actgcgcatccgaccgaagtcagccgacgcaccctgattcaaaaatatgacgatatcaat
gatgccctgtcaaaactcgatcagcaaaagctgaccccgcaagagcgtgagcaagtgctc
accaacctgaagcatttgatctgttcggcatggcagaccgatgaaattcgtcaaaacaag
ccaacgccgctcgatgaagccaaatggggttttaccaccattgaacaaaccttgtggaac
gcggtacctaaatttgttcgagaactaaatacactggtgcatcagcactgcaacgcgacc
ttaccacttgatatttctccaattcgttttgcctcatggatgggcggcgaccgtgacggc
aatccgaatgtcacacacacggtcacgcaagaagtgttgtggctgtcgcgctggcaagcg
gccgatctgtatctgcgtgatatcgaaagtttacgctgggaactctcgattcaggcctgt
tctgaagaattaagccttgcgctgggtcgtagtcatcccgagccataccgtgaatactta
cgtaccacgcgtgaacgcctgaaagctacacgtcactggttgtcgctacgcttgcaaggt
ctggatggcgatgacagtcagattatccgccacaaacaggaattacttgaaccgttgctg
ttgtgtcatcgttcactgatcgcctgtaacttaccggaactggccaatggcaagctgctc
gattttatttaccgcgtaaactgctttggtatcgaactgcttaaactggatattcgtcag
gaatcggggcgtcatcgtcaggcgatttccgccattaccgaatatttaggcttgggtaat
ttcgaatcctggactgagcaagcccgtcaaaactttctgattcaggaattgcaaagcaaa
cgcccgcttctgcctaaatatcttaaagaaccagaaggtagcctgattgaacacccagat
gtcaaagaagtgtttgccaccatgcgtacactggccgagcagccgccagaaagtttgggt
gcatatattatttccatggccgaatatccaagcgatgtcctagccgttttgcttctgcaa
aaagaagccggtattttgcatccgcttcgtgtggtaccactgtttgaaaccttaaaagat
ttagacggcgcagccaaaaccatggaaacgctgtttaatatggactggtacaagcagcat
attcagggcaaacatgaagtcatgatcggttactccgactctgccaaggacgcaggcttt
atgtcggccaactgggcacagtatcgtgcgcaggaagaactgacggcggtggccaaggcg
cacaatgtacagctcaccttatttcatggtcgtggcggctcgattagccgtggcggggcg
ccaacacagcaggccctgttttcacaaccacctggctctatttctggagccattcgtgtg
actgaacagggtgagatgatccgctttaaatttggtttagaaggcgttgcgttacaaaac
cttgaagtgtataccgcagcaacccttgaagcgaccttactgccaccacccgtaccgaag
gcagagtggcgtgagctgatgcatcagatgacggacatttcagttcgcgtatatcgcgaa
accgtgcgtgaaaatcctcattttgtacagtacctgagaaccgtgacgcctgagcttgaa
ctgcaaatgttgccactgggttcacgaccggccaaacgtaaagtaagcggcggaatcgaa
tcgttacgtgccattccttgggtatttgcatggacgcaaattcgactcatgttgccagct
tggctcggcactggtgcagccattaatcaagtgatcgatgaaaacaaaaagccgctgctc
gacgaaatgttggcagaatggccgtacttccaaaccctgatcgatatgctggagatggtt
ctctccaaagccgatgccaatgtcgcgttgtattacgaatcacatcttactcatgatgat
gagcttaaggtactgggcgaaatgctgcgcgcacgtttgaacgatgccgttcagacctta
ttgaccatgaaaggtgagtccaagctgctcagtaaaaacgatgtactggatcaagccatg
caggtacgtaaaccctacctgttgccattgcatttacttcaggcagaactgatgaaacgg
cgtcgtgaatacacggcaaaaaccaacgccgatcatacacctgtcgatcacgcactgatg
gtgagtatcgccggaattgcagcgggtctgcgtaatacgggctaa

DBGET integrated database retrieval system