Alteromonas stellipolaris LMG 21856: AOR13_3679 Help Entry AOR13_3679        CDS       T04153                                  Name (GenBank) DNA-binding protein Fis   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism asp  Alteromonas stellipolaris LMG 21856 Brite KEGG Orthology (KO) [BR:asp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:asp03000]     AOR13_3679    03036 Chromosome and associated proteins [BR:asp03036]     AOR13_3679    03400 DNA repair and recombination proteins [BR:asp03400]     AOR13_3679 Transcription factors [BR:asp03000]  Prokaryotic type   Helix-turn-helix    Other families     AOR13_3679 Chromosome and associated proteins [BR:asp03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AOR13_3679 DNA repair and recombination proteins [BR:asp03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       AOR13_3679 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HTH_8 DUF5805 DCAF17 Phage_NinH EnY2 HTH_28 DUF2106 Motif Other DBs NCBI-ProteinID:  ALM92672 UniProt:  A0A0S1YQH0 LinkDB All DBs Position complement(4265230..4265523) Genome browser AA seq 97 aa AA seqDB search MFDQNVTSPFTTTVTTPSQTQAQKPLRDSVKQAVNKYLKQLDNANIDNLYEMVLAEVEAP LLEEVMTYTRGNQTRAAIMMGINRGTLRKKLKQYGMN NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgttcgatcaaaacgtgacttcaccttttactactacagtaactacgccttctcagacg caagcacaaaagccacttcgtgactcagtaaagcaagcggttaataaatacttgaagcaa ctggacaacgccaacatcgataatttatacgaaatggtactggccgaagttgaggccccg ctgctggaagaagttatgacttacacccgcggcaaccaaacccgcgctgccattatgatg ggaatcaaccgtggcacgcttcgcaaaaagctgaagcagtacggcatgaactaa

DBGET integrated database retrieval system