KEGG   Alteromonas stellipolaris LMG 21856: AOR13_3794Help
Entry
AOR13_3794        CDS       T04153                                 

Definition
(GenBank) MdlB protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
asp  Alteromonas stellipolaris LMG 21856
Pathway
asp02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:asp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AOR13_3794
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:asp02000]
    AOR13_3794
Transporters [BR:asp02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    AOR13_3794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 SbcCD_C AAA_29 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ALM92787
UniProt: A0A0S1YQV2
LinkDB All DBs
Position
4372172..4374019
Genome map
AA seq 615 aa AA seqDB search
MKSKPLQPAVSAQGIAASKASSSLTEQTSIAAYGALGLALLHGIAGLSILIISSWFIAIS
AIAPLGFNYVIPAVVIRGLALLRIASGYTTMWLGHKDLLTRIAKARLAVFEQLAAKRLES
KAWTVEALANHTEQLASAFIAWVSPLASVMLLMTGLLLTGYFMNMPGYGFFIALAIVWLV
ISVVTAVYGLKAVAGSAEAELEFRQQSATFFQASSLWHLKSKTVKGLFNAPSTHRVQDAQ
LKEQALVSKAMWLFQGGVFTLVALVVFTANTAAYFVPLALITPMVLLAAPDWASATFSSV
VKFAKWRHSKAELHAMHTQSLPLLNAHKPSMSLSLTGFIAKERNLPAVNMQFEALGLNVI
KGYSGCGKSSVLQAICGLLPFDGRRSIDNVATPQGMLEKWLYVEQHPIILAGTIKLNLDP
AASGISEDAMHNVLARVGLQHLTTLAEWVGKGGRALSGGEGKRLALARALLAMPDVLLID
EPFEGLDYEAQQRVAEVINESAHSRLVIVATHVVPAALQPNTTFSLDEKGYQNKSHPSLH
TQPNGTQLSYSQPRHNQLSLNQIDHAHQNTVGEGGWQVTSPNCTTLTPSEQQQQALAELQ
HHERNTAFGFKPRRK
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccaaaccgttacagcctgctgtatctgcgcaaggtatagctgcatcaaaagcg
tcttcgtcactcaccgagcagacgtcaatagcagcgtatggcgcgctgggcttagccttg
cttcatggtatagcgggtttgagtattcttatcatttcatcttggtttattgccattagc
gcaatagcccctttagggtttaactacgtgatccctgcggtggtgattcgtgggctcgca
ctacttcgtatcgcttctggttacaccaccatgtggctaggacacaaggatttattaacc
cgaattgccaaagcacggttagctgtgtttgagcaattagcggcaaaacgccttgaaagc
aaagcatggacagttgaagcgctcgcgaaccacactgagcaacttgcctcagcttttatt
gcgtgggtttctccattagcctcggttatgctgctaatgacaggcttgttgctcacgggg
tatttcatgaatatgccaggttatggttttttcatagccctagccatagtgtggttggta
attagtgttgttactgcggtttacggactgaaagccgtggctggttcggctgaggcagag
cttgaatttcggcaacaaagcgcgacgttttttcaagcaagtagtttatggcaccttaag
tcaaaaacggtaaagggcttgtttaatgcaccctctactcatcgcgtacaagatgcacaa
ctaaaagagcaggcactagtgtctaaagctatgtggctgttccaaggtggcgtgttcact
ttagtggcgctggttgtttttactgccaatacggcagcctattttgttccgctagcactc
attacgccaatggtgctattggctgcaccggactgggcgagcgccactttcagcagtgtc
gtgaagttcgctaagtggcgacatagcaaggcagagctacacgcaatgcacacccagtct
ttgcccttactaaatgcccataaacccagcatgtcactttctttaacgggttttatcgct
aaagaaagaaacctaccagcggtcaatatgcagtttgaggcattagggctgaatgtgatt
aaaggctattcggggtgcggtaagtcgagcgtactacaagcaatatgcgggctccttcct
tttgacggtcgacgctctatagacaatgttgccaccccgcaaggcatgctagaaaaatgg
ctttatgttgaacagcaccccatcattttggccggtactattaaactcaatttagatccg
gcagcgtctggaataagcgaagatgctatgcacaatgttttagcccgggttggtttgcag
caccttactaccttggctgaatgggttggtaaaggaggaagggcgttatctggcggtgaa
ggtaagcgtttagcattggccagagccttattagcgatgcccgatgtgttgttaattgat
gaaccttttgaagggctagactacgaagcacagcagcgcgtcgccgaggtcattaatgaa
agtgcgcattcgcggttagtcattgttgctacccatgttgttcctgcggcccttcaacct
aatacaaccttctcgcttgatgaaaaaggttatcagaataaatctcaccccagtcttcat
actcaaccaaatggcacccagctaagttatagccaaccaagacacaaccaactaagcctt
aaccaaatagatcatgcccaccaaaacacggttggcgaaggtggatggcaggtaacgtcg
ccgaattgcacaacgctaacgcctagtgaacagcagcaacaggctttggcagagctgcaa
caccacgagcgcaacacggcttttggttttaagccgcgaaggaaataa

DBGET integrated database retrieval system