KEGG   Alteromonas stellipolaris LMG 21856: AOR13_430Help
Entry
AOR13_430         CDS       T04153                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
asp  Alteromonas stellipolaris LMG 21856
Pathway
asp00473  D-Alanine metabolism
asp00550  Peptidoglycan biosynthesis
asp01100  Metabolic pathways
asp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:asp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AOR13_430
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AOR13_430
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AOR13_430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:asp01011]
    AOR13_430
Enzymes [BR:asp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AOR13_430
Peptidoglycan biosynthesis and degradation proteins [BR:asp01011]
 Precursor biosynthesis
  Amino acid ligase
   AOR13_430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp GARS_A ATPgrasp_Ter ATP-grasp_3 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ALM89482
UniProt: A0A0S1YGH9
LinkDB All DBs
Position
539443..540411
Genome map
AA seq 322 aa AA seqDB search
MSLFSNVTKYDAAAFGKVAVMFGGDSAEREVSLNSGNAVLAALLRQNVNAIAFDPAKRPL
TDLISEKVDRVLIMLHGRGGEDGSMQGALQLLKIPYTGTPVLGSALAMDKIHTKQVWQSL
GLPTAKYEIADKRRFEAGKCSAIMEKLGNEVMVKPAREGSSIGMARVTSAEQLENAIQDA
FNYDNQVLLEQYINGPEFTVSVIQGQALPSIRMSTPHTFYDYAAKYQDDTTEYFCPSGLS
DEQEAHLAQLSTQAFDSISGSGWGRIDVMQDSDGHFYLLEANTVPGMTEKSLVPKAAKVA
GLSFDELVLAILATSFDPDSRA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcctttttagcaacgtaacaaaatatgatgctgccgcctttggaaaagttgcggtc
atgtttggcggcgattctgctgaacgtgaagtgtcgctaaactcaggcaacgcagtgctt
gcagcacttttacgacaaaatgtgaatgccattgcttttgatccagctaagcgcccactg
actgatttgatcagcgaaaaagtcgaccgagtgcttatcatgttacacggccgaggtggt
gaagatggctcaatgcaaggggcacttcaactgcttaaaattccctatacgggaacgccg
gttttaggttctgcattggcgatggacaagattcacaccaagcaagtatggcaaagcctt
ggcttacctactgctaaatatgaaattgctgataaaaggcgctttgaagctggtaagtgc
agcgctataatggaaaagttggggaatgaagtcatggtaaaaccggcccgagaagggtcg
agtattggcatggcaagagtgacaagcgctgaacaactcgaaaatgccatacaggacgcc
tttaactatgacaatcaggttctgttagagcaatacataaatggccctgaatttacggtt
tcagtaattcaggggcaggcattgccgtctatccgcatgtctactcctcatacgttttat
gattatgctgcaaagtaccaagacgataccaccgaatacttttgtccaagtggtttgtct
gacgagcaagaagcacatcttgctcagctatcgacgcaggcattcgattctatttctggc
tctggctggggtcgcattgacgtgatgcaggatagtgacgggcacttttatttgcttgaa
gcgaatacggtgccgggaatgacggaaaaaagcttggtgcctaaagcggccaaagtggca
gggttaagttttgacgaactggtgttggcaatattggccaccagttttgaccctgacagc
agagcataa

DBGET integrated database retrieval system