KEGG   Alteromonas stellipolaris LMG 21861: AVL57_04195Help
Entry
AVL57_04195       CDS       T04545                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
Organism
asq  Alteromonas stellipolaris LMG 21861
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C Pyr_redox_2 HI0933_like Pyr_redox Pyr_redox_3 3HCDH_N AdoHcyase_NAD FAD_oxidored FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AMJ73247
LinkDB All DBs
Position
complement(705844..706869)
Genome map
AA seq 341 aa AA seqDB search
MFAAQYAGEKTFNIQPGTTVPPGPGEVRLSVGYVGICGTDMHIYHGVMDARVAPPQIIGH
EMSGVVAEVGEGVKNVVIGDHVVVRPLDYCLNCPACDAGHSHVCQNLKFMGIDTPGAFQS
SWTVKSRTLHKLPSNVSLKMGALVEPLAVACHDVARARVAKGEDVVVIGGGPIGQLVAMV
AKAKGANVIISEVNATRRQFSEDNGINTIDPINQDPVAEIAKVTNGKGADVVFEVSGVQP
AVDVMTEIAAVRGRICMVAIHSQKPQVDLFKFFWKELELLGARVYEHEDFEQAIKLIADG
SLDLEPLISSVSKINDIGSAFASMDGNPSGMKALVSLSEEF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagcacaatacgcaggtgaaaaaacctttaacattcaacctggaaccacagtt
ccaccaggacccggagaagttcgactttcagttggttatgttggaatttgtggtacagac
atgcatatatatcacggcgtgatggacgcacgtgttgcccctccccaaattataggtcat
gaaatgtcaggggtggtagccgaggtaggtgaaggcgtaaaaaatgtggttataggtgac
catgtcgttgtccgcccgcttgattattgcctgaattgccccgcttgtgatgcgggtcat
tcacacgtttgccaaaaccttaaatttatgggtattgatactcctggtgcattccaaagt
tcatggacagtgaaatcacgcacgttgcataaacttcctagtaatgtttctttaaaaatg
ggcgcccttgttgagcctcttgcagtggcttgtcacgatgttgctagagcacgtgttgca
aaaggtgaggacgttgtggttattggcggtggccctatcggtcaactcgttgcaatggta
gctaaagctaaaggggcgaatgtcatcatctctgaagttaatgccactcggagacaattt
tcagaagataatggtattaatacgattgatccaataaaccaagacccggttgccgaaatc
gcgaaagtgactaacggaaaaggcgcagatgtggtctttgaagtttcaggcgttcagcca
gccgttgacgtgatgacagaaatcgcggcagtgcgtggtcgcatttgcatggtggccatc
cactcacaaaaacctcaggtcgatctcttcaagttcttttggaaagaattagaactgcta
ggtgctcgggtatatgagcatgaagactttgagcaagcgattaagctaattgcagatggc
tcactagatcttgagccgcttatcagctcggtaagcaaaatcaatgatattggtagtgct
tttgcttctatggatggtaacccttctggtatgaaagcactcgtgtcgttaagtgaggaa
ttctaa

DBGET integrated database retrieval system