KEGG   Alteromonas stellipolaris LMG 21861: AVL57_07945Help
Entry
AVL57_07945       CDS       T04545                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
asq  Alteromonas stellipolaris LMG 21861
Brite
Enzymes [BR:asq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     AVL57_07945
Peptidases [BR:asq01002]
 Metallo Peptidases
  Family M2
   AVL57_07945
Exosome [BR:asq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AVL57_07945
CD molecules [BR:asq04090]
 Proteins
  AVL57_07945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AMJ73919
LinkDB All DBs
Position
1601647..1603470
Genome map
AA seq 607 aa AA seqDB search
MFSTKRTIVAALVSITLIGCGEATSKTETTPAAPTAQDAQEFLINAQNDISKMQVPAAHA
EWSYATNINFDTAAVSAYFNEVLSTKVAVLAKEAAKFNDVEVDEDTRRQLNLLKNGLTMP
PPSDPAKAEQLAKIGSELSAMYGSGQYCMEDGTCKSLVEMSSEMATIRDADTLLEYWKGW
REVSVPMKPLYEQQVNLANEGAAELGFQNVSELWRGKYDMPADDFPKELDRLWGQVAPFY
ESLHCHVRAKLGEHYGEELVPQDQPIPAHLLGNMWAQTWGNVYDIVKPEQEMSVPDVTSS
LVAQGYDEIKMVKQAESFFSSLGFAPLPDTFWERSMFQKPEGRDAQCHASAWDLDDKDDL
RIKMCIQKTGEEFNVIHHELGHNYYQRAYKDQPLLYRGSANDGFHEAIGDTIALSITPKY
LKEIGLIDEIPDASNDIGMLMQVALDKIAFIPFGLMVDQWRWKVMAGEVSPEQYNTLWWE
LREKYQGVKAPIDRPADAFDPGAKYHVPANVPYTRYFLAHILQFQFHKALCDIAGDEGPL
NRCSIYNSEEAGTALNAMLEMGVSEPWQKALETLTGSPEMDASTIADYFAPLKTWLDEQN
ATRQCGW
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaactaaacgcactatcgtcgcagcactagttagcattacgctaataggttgc
ggtgaagccactagcaaaactgaaacaacacctgcggcacctaccgcgcaagatgcgcaa
gaatttcttattaatgcgcaaaacgatattagtaaaatgcaggtaccagccgctcatgcc
gagtggagttacgctactaacatcaattttgataccgccgcagtaagtgcctatttcaat
gaagtactgtccaccaaagtagctgtgttagccaaagaagcggctaaatttaacgatgtt
gaagttgatgaagatacccgtcgtcaacttaacctgcttaaaaacgggctgaccatgcca
cctccttcagatccggcgaaagcagaacaacttgctaaaattggttctgagctaagtgca
atgtatggttccggccagtactgcatggaagacggcacctgtaaaagcttggtagaaatg
agcagtgaaatggcgactattcgcgatgccgacaccttactagagtactggaaaggttgg
cgcgaagtgtctgtgcctatgaagccgctgtatgaacaacaggtaaatttggctaacgaa
ggtgctgctgaattaggctttcaaaatgtgagcgaactatggcgcggtaaatacgatatg
ccagccgacgacttcccgaaagaacttgataggttgtggggacaagttgcgcctttctac
gaatcgctgcactgccacgttcgtgctaagttaggtgagcattatggtgaagaattggtt
cctcaagaccaaccaattccagcacacttgttaggcaatatgtgggcgcaaacctggggc
aacgtttacgatatcgtgaagcctgaacaagaaatgtcagtacccgatgttacctcatcg
ctcgtggctcagggctatgatgaaataaaaatggtaaaacaggctgaatctttcttttcg
tcattgggctttgcgccgctgcctgatacgttttgggagcgctctatgttccaaaaacct
gaaggccgcgacgcacagtgtcacgcttcagcatgggacttagatgacaaagacgattta
cgtattaagatgtgtattcaaaaaacgggggaagagtttaacgttattcatcatgaactg
ggccacaactattaccaacgtgcttataaagaccagcctttgttgtatcgcggttcagct
aacgatggcttccatgaagcgattggcgacaccattgccttgtcgattacccctaagtac
ttaaaagaaattggtttgattgacgagatcccagatgcgtctaacgacataggcatgcta
atgcaggtggcgctagataaaattgcctttattccatttggtttgatggtggatcaatgg
cgctggaaagtgatggccggtgaagtatcgcctgagcaatacaatacactttggtgggaa
ttaagagaaaagtaccaaggtgtaaaagcaccgatagacaggcctgcagatgcgtttgac
ccaggcgctaaatatcatgttccggctaacgtgccctacactcgctacttcttagcgcat
attttgcaattccagttccataaagccttgtgtgacattgccggtgacgaaggcccactt
aatcgctgttctatttataacagtgaagaagcgggtaccgcgctaaacgccatgcttgaa
atgggcgtaagtgaaccatggcaaaaagcgttagaaactcttactggctcacctgaaatg
gatgcaagtaccattgctgactactttgcaccgctaaaaacgtggttagatgagcaaaat
gcgacgcgtcagtgtggatggtaa

DBGET integrated database retrieval system