KEGG   Alteromonas stellipolaris LMG 21861: AVL57_09910Help
Entry
AVL57_09910       CDS       T04545                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
asq  Alteromonas stellipolaris LMG 21861
Pathway
asq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
asq01100  Metabolic pathways
asq01110  Biosynthesis of secondary metabolites
asq01130  Biosynthesis of antibiotics
asq01230  Biosynthesis of amino acids
asq02024  Quorum sensing
Module
asq_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:asq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AVL57_09910
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AVL57_09910
Enzymes [BR:asq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     AVL57_09910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 SHMT
Motif
Other DBs
NCBI-ProteinID: AMJ74256
LinkDB All DBs
Position
complement(2049652..2050743)
Genome map
AA seq 363 aa AA seqDB search
MIKDTVNNIHVSAEDVLITPETLSAELPASEKALAAISDSRKIVSDIIHRRDHRLLVVCG
PCSIHDVEAAKEYALKLKELHESCKDTLFIVMRVYFEKPRTTTGWKGLINDPHINDTFDI
EAGLRKARELLIWLAELELPVATEALDPISPQYLAELFSWSAIGARTSESQTHREMASGL
SMPVGFKNGTDGSLDIALNALKSAASGHRFMGINKQGQVSVIATSGNPDGHIILRGGKQP
NYDSVCVSECEVEMQEAGLTAGLVVDCSHANSSKDYRRQPLVAQNVVNQILEGNQSIIGV
MLESHLKAGNQKSDGKKLSEMEYGVSITDGCIDWETTESLIAQTRDKLITVLPLRQNKRT
DVA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggacactgtaaataatatccacgtaagtgcagaagatgtacttattacgcca
gaaacattaagtgctgagttgcctgcctcagaaaaagcacttgctgccatttcagattct
cgcaaaattgtttctgatatcattcaccgccgtgaccatcgtttgttggtagtatgtggg
ccatgttctattcacgatgtggaagcagctaaagaatacgcgcttaagttaaaagaactg
catgaatcatgcaaagatactttattcatagtgatgcgtgtttactttgaaaagccacgc
accacaacgggttggaaaggattaattaacgatcctcatattaacgacacattcgatatt
gaagctggcctgcgtaaagcccgtgaattattgatttggttggccgaactcgaacttccg
gtagcgactgaagcgctagatccaattagtcctcagtacttagcagagttattcagctgg
tctgcaattggtgctcgtacttctgaatcacaaactcaccgtgaaatggccagtggtctt
tcaatgcctgtaggttttaaaaatggtactgatggcagcttagatatagccctaaatgcg
cttaagtcagcagcatcaggtcatcgcttcatgggtattaataagcaaggtcaagtaagt
gttatcgcgacaagtggtaacccagatggccatattattttacgtggcggcaaacaacct
aactacgattcggtgtgtgtatctgagtgtgaagttgaaatgcaagaagcagggctaaca
gcaggcttagtggtcgattgtagccatgctaactcctcaaaagattaccgtcgtcagcca
ttggttgcacaaaatgtagtaaatcaaatactagaaggtaatcagtctattattggcgtg
atgttagaaagccacttaaaagccggtaaccaaaagtctgatggcaaaaaactaagcgaa
atggaatacggtgtgtctataaccgacggttgtattgactgggaaacaacagaatcgctt
attgcccaaaccagagataaattaataactgtgctaccattacgtcaaaataagcgcacc
gatgttgcctaa

DBGET integrated database retrieval system