KEGG   Alteromonas stellipolaris LMG 21861: AVL57_10880Help
Entry
AVL57_10880       CDS       T04545                                 

Definition
(GenBank) chemotaxis protein CheA
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
asq  Alteromonas stellipolaris LMG 21861
Pathway
asq02020  Two-component system
asq02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:asq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AVL57_10880
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    AVL57_10880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:asq01001]
    AVL57_10880
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:asq02022]
    AVL57_10880
   02035 Bacterial motility proteins [BR:asq02035]
    AVL57_10880
Enzymes [BR:asq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AVL57_10880
Protein kinases [BR:asq01001]
 Histidine kinases
  CheA family [OT]
   AVL57_10880
Two-component system [BR:asq02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   AVL57_10880
Bacterial motility proteins [BR:asq02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AVL57_10880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW Hpt HATPase_c H-kinase_dim HATPase_c_3 DUF1018 ORC6 Arteri_nsp7a
Motif
Other DBs
NCBI-ProteinID: AMJ74422
LinkDB All DBs
Position
complement(2279289..2281517)
Genome map
AA seq 742 aa AA seqDB search
MAFDVDEDILQDFLVEAGEILEQLQEQLVDLENNPEDGDLLNAIFRGYHTVKGGAGFLSL
TELVEICHGAENVFDVMRNGQRTLTPELMDTILQATDVVVDMFERVKAQEPLVPADAKLV
DLLHKLSTPETPDENIFGDSSEAAEAPAAEVVEEEFALEEAPVPEAPAASSDGGIDEISE
DEFEALLDELHGSNAPGKSAPKAEPKAAAPAAVGSGDDITDDEFEALLDELHGKGKFKEE
EPAPAAAPKAAAPSGEEITDDEFEALLDQLHGSGQGPTAQGSEPAANTPPVDKKATEAIQ
KAKAEQSAASTPAKSTPAAKAPAPSPAAKKAPEPAKAAAKKDDKKANPTPPQAETTVRVD
TKRLDQIMNMVGELVLVRNRLLSLGINNADESMSKAIANLDVVTGDLQGAVMKTRMQPIK
KVFGRFPRVVRDLARSLKKEITLELEGEETDLDKNLVEALADPLVHLVRNSVDHGIEMPD
DRAATGKARMGTVRLSASQEGDHILLTIEDDGKGMDAEKLKEIAISRGVLDADAAARMSD
VEAFNLIFAPGFSTKTEISDISGRGVGMDVVKTKINQLNGTINIDSHLGKGTRLDIKVPL
TLAILPTLMIVVGKQTFALPLGAVNEIINMDIKKTNTVDGQLTMIVRSKAIPLFFLGEWL
IRGPKNIIKDKGHVVVVQIGTQQVGFVVDALIGQEEVVIKPLDALLQGTPGMAGATITSD
GGIALILDVPSLLKRYARKPLK
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttgatgttgacgaggatatattacaggactttctagttgaagctggggagatc
cttgaacaattacaagaacagctcgttgatctggaaaataatcctgaagatggagattta
cttaatgctatcttccggggttaccataccgtaaaaggtggcgccggctttttgtcgctt
accgaattagttgaaatttgccacggtgcagaaaacgttttcgatgtaatgcgaaacgga
caacgtactcttacgcctgaattgatggacaccattcttcaggccaccgatgtagtagta
gatatgtttgagcgtgttaaagcgcaagagccgctagtacctgcagacgcaaagttagtt
gatttgctgcataagttaagcaccccagaaaccccagatgaaaatatctttggtgacagt
agtgaggcggctgaagcccccgctgccgaagttgtcgaggaagaatttgcgttggaagaa
gcgcccgtacctgaagcgcctgctgctagcagcgatggcggtattgacgaaatttcagaa
gatgaatttgaagccttacttgatgaacttcatggttcaaatgctccgggtaaatctgcg
cctaaagcagaaccaaaagcggctgcacccgctgccgttggttcaggtgatgatatcacc
gacgacgaatttgaagcactgttagacgaattgcacggtaaaggtaaattcaaagaagaa
gaacccgcacctgcagctgcgcccaaagcagctgcgcctagcggtgaagaaattactgac
gatgagtttgaagcactacttgaccaactacacggttcaggacaagggcctacagcgcaa
ggctctgaaccagcagcaaatactccgcctgtagataaaaaagcgacagaagcaattcag
aaggctaaagcagagcaatctgccgctagtacgccagctaaatcaacgcctgccgcaaaa
gcgccagcgcctagtccagcagctaaaaaggcgccagagcctgctaaagccgcggctaag
aaagacgacaaaaaagcaaacccaacacctcctcaagcagaaaccacagtacgtgttgat
actaagcgcctagaccaaattatgaatatggtcggtgagttagtattggtacgaaatcgt
ttgctgagtttaggaataaacaatgccgacgagagtatgtctaaggcaattgctaacctt
gacgtggtgactggcgatttgcagggtgcggttatgaaaacccgtatgcagccaattaag
aaagtgtttggccgcttccctcgcgttgttcgagacttagcacgtagtttgaaaaaagaa
atcaccttagagttggaaggtgaagagacagatttagataaaaacctggtagaagcattg
gccgatccgttggttcacttagtgagaaactcagtggatcatggtattgaaatgcctgat
gaccgtgctgctacaggtaaagcccgaatggggaccgtgagattatcggcttctcaagaa
ggtgatcatatcctacttaccattgaagatgacggtaagggaatggatgctgaaaaacta
aaagagattgcgataagtcgaggtgttttagatgccgatgcggctgcgcgtatgtctgat
gttgaagcgttcaatctcatttttgcaccaggtttctctacaaaaactgagataagtgat
atctcgggccgtggtgtaggcatggatgtggttaaaacaaaaattaatcagcttaacggt
accattaatattgattctcaccttgggaaaggcacgcgactcgatattaaagttccactt
acgcttgcgattttaccgaccctaatgattgtggttggcaaacaaacgttcgcgttaccg
ttaggtgcggtcaacgaaattatcaacatggacatcaagaaaaccaatacggttgatggc
caattaaccatgatagttcgttctaaagcgataccactgttcttccttggagaatggttg
atccgtggacctaaaaatataatcaaagataaaggtcacgtcgtcgtggttcaaataggc
acccagcaagttggttttgttgttgatgcgctaataggccaagaagaagtggtgataaaa
ccattagatgccttattacagggaacgccaggtatggcgggagcaactatcacatccgac
ggtggaattgcactcatcctagatgttcctagcttactgaagcgttatgctcggaagcct
ttaaagtaa

DBGET integrated database retrieval system