KEGG   Aeromonas schubertii: WL1483_1809Help
Entry
WL1483_1809       CDS       T04186                                 

Definition
(GenBank) alpha-amylase, extracellular
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
asr  Aeromonas schubertii
Pathway
asr00500  Starch and sucrose metabolism
asr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    WL1483_1809
Enzymes [BR:asr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     WL1483_1809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ALP41228
UniProt: A0A0S2SHR0
LinkDB All DBs
Position
complement(962586..963983)
Genome map
AA seq 465 aa AA seqDB search
MKHTAGFLVAASLLTAPLAQADVILHAFNWKYADITAQADAIKAAGYKMVLVSPPLKSSG
NEWWARYQPQDLRLIDNPLGNKQAIEQLITAMSSRGIAVYADVVLNHMANETWKRPDLNY
PGQELLGQYAANPTYFERQKLFGDLGQNFLSGGDFHPEGCISNWNDPYNVQFWRLCGGAG
DRGLPDLDPNNWVVSQQQAYLKALKQMGFKGFRIDAVKHMSPYQIGAIFTGEITSGMHVF
GEVITSGGAGAGDYETFLRPYLDATNHGAYDFPLFASIRSAFSYGGSMNQLADPGAYGQA
LPGSRAVTFAITHDIPTNDGFRYQILGQQDEKLAYAYLLGRDGGTPMVYSDHGETKDKDG
LRWQDYWKRTDLKGMIRFHNAVQGQPQQLIGSGDCFVLFKRGKAGLVGINKCDSEQEYWL
DTGKFEMNWNRNYRDVLDASAVVNVQSQWVRLAIPPRSARMWMQE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacacagcgggctttctggtggcagcatccttgctgaccgcccctctggcgcag
gcggatgtcatcctccacgccttcaactggaaatacgccgacatcacggcccaggccgac
gccatcaaggcggcgggctacaagatggtgctggtctcccctcccctcaagtcctcgggc
aacgagtggtgggcacgctatcagccccaggatctgcggctcatcgacaaccctcttggc
aacaagcaggcgatcgagcagctgatcaccgccatgtcgtcgcgcggcatcgccgtctac
gccgatgtggtgctcaaccacatggccaacgagacctggaagcgtccggatcttaactac
ccgggccaggagctgcttggccagtacgccgccaaccccacctatttcgagcgccagaag
ctgtttggggatctcggccagaacttcctctcgggcggtgacttccaccccgaggggtgc
atcagcaactggaacgatccctacaatgtgcagttctggcgcctgtgtggcggggccggc
gatcggggcctgccggatctcgatcccaacaactgggtggtgagccagcagcaggcctac
ctcaaggccctcaagcagatgggcttcaagggctttcgcatcgatgcggtcaagcacatg
agtccctatcagataggcgccatcttcaccggcgagatcacctcggggatgcacgtcttc
ggcgaggtgatcacctcgggcggcgccggtgccggggactacgagaccttcctgcgcccc
tatctcgacgcgaccaaccacggggcctatgacttccccctgtttgcctcgatccgctcg
gccttctcctatggcggcagcatgaaccagctcgccgatccgggggcctatggccaggcc
ctgccgggcagccgcgccgtcacctttgccatcacccacgacatccccaccaacgatggc
ttccgctaccagatcctgggtcagcaggacgagaagctggcctacgcctatctgctcggc
cgcgacgggggcacccccatggtctactccgaccacggggagaccaaagacaaggacggg
ctgcgctggcaggactactggaagcgcaccgacctcaagggcatgatccgcttccacaat
gcggtgcaggggcaaccccagcagctgatcggcagtggcgattgcttcgtgcttttcaaa
cggggcaaggcgggcctggtcggcatcaacaagtgcgacagtgagcaggagtactggctc
gacaccggcaagttcgagatgaactggaaccgcaactaccgggacgtgctggatgccagc
gccgtggtcaacgttcagagccagtgggtgcgcctcgccatcccgccgcgctcggcgcgg
atgtggatgcaggagtaa

DBGET integrated database retrieval system