KEGG   Aeromonas schubertii: WL1483_308Help
Entry
WL1483_308        CDS       T04186                                 

Definition
(GenBank) hypothetical protein
Organism
asr  Aeromonas schubertii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ALP39727
UniProt: A0A0S2SDK9
LinkDB All DBs
Position
complement(1375899..1376543)
Genome map
AA seq 214 aa AA seqDB search
MPATFTLGAKGNNGFSHTDNVTISQGADAQYHADVSRNYLFGKGSSDGKTSRALATYIQS
QLPQPQRQQPLSPPALQQVQPLQPNPQTQRQQTFDQIFPPLPPRSDDEERALIDARYQRD
KHQAAFVAIQPGPPTANPDNKAIADAVNRLTSGFVKSDYHREGIKQLGILLDNLSRQGYD
ISNHALQDAVFGVHAAYHSAGYDSINSVCQTLLK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccacctttacccttggcgccaagggtaacaacggtttttcacacaccgataac
gtcaccatcagtcagggtgcggatgcgcagtatcacgcagacgtcagccgcaactatctg
ttcggtaaaggctctagtgacggcaagacctcccgggcgctggccacctacatccaaagc
cagttgccccaaccacagcgccaacaacccctgtcgccgcccgccctgcagcaggttcag
cccctccaacccaacccgcagacgcagcggcaacagacctttgaccagatctttccccct
ctgccaccccgtagtgacgatgaggagcgcgccctgatagatgcccgctaccaaagagac
aaacatcaggctgcctttgtggcgatacaaccgggccccccaaccgccaaccctgacaac
aaggccatcgccgatgccgtcaaccgtctcacatcaggcttcgtcaagagtgattaccac
agggaggggatcaaacaactgggcatcctcttggacaacctctcccgacagggatacgac
atcagcaaccacgctctgcaagacgccgtgtttggtgtacacgcggcctaccacagtgcc
ggttatgactccattaacagcgtctgtcagacgctcctgaaataa

DBGET integrated database retrieval system