KEGG   Aeromonas schubertii: WL1483_3598Help
Entry
WL1483_3598       CDS       T04186                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
asr  Aeromonas schubertii
Brite
KEGG Orthology (KO) [BR:asr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    WL1483_3598 (ahpF)
Enzymes [BR:asr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     WL1483_3598 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored FAD_binding_3 Thi4 NAD_binding_8 AlaDh_PNT_C NAD_binding_7 K_oxygenase FMO-like Glutaredoxin FMN_bind NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ALP43017
UniProt: A0A0S2SMU5
LinkDB All DBs
Position
2839719..2841305
Genome map
AA seq 528 aa AA seqDB search
MLDTNLKQQLNTYLQYIVHPIEISVSGNDSDKSAELLALASEISGMSPKITQTSGTAARK
PSMSVATQGQAPRIHFAGIPMGHEFTSLVLALLQSGGHPSKADPAVQEQIKSLKGEFHFE
TYISLSCHNCPDVVQALNLMATLNPGITHTMIDGALFQEEVNERQIMAVPNVYLNGQPFS
QGRISLEEIVAKLDTGAAERKAAELNEKDPYDVLVVGGGPAGAAAAIYAARKGIRTAIVA
ERFGGQVMDTVGIENFISVPYTEGPKLAASLEQHVKQYGVEVITEQRAAAISRDGYVNVD
LASGATLKSRAVILATGARWRDLNVPGELEYRTKGVAYCPHCDGPFFKGKRVAVIGGGNS
GIEAAIDLAGIVEHVTVVEFADTLRADEVLQKKARSMSNIDIIMSARTTEVIGDGSKVVG
MDYEDRTTGEIKHLAVAGIFVQIGLVPNTEFLKGSEVALTRFGEIEIDTKGATSLPGVYA
AGDATTVPFKQIIISMGAGATAALGAFDYLIRNPAPEAATAEADAVIA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctggataccaacctcaaacaacagctgaacacctatctgcagtacatagtccatccc
atcgagatcagcgtgtccggcaacgacagtgacaaatccgccgaactgctggcactggcc
agcgagataagcgggatgtcacccaagattacccagacctctggcactgccgcccgcaag
ccttccatgagcgtggccacccagggccaagccccgcgcattcactttgccggcattccc
atgggtcatgaatttacttctctggtgctcgccctgctgcaaagcggcggtcacccctcc
aaggccgatccggccgtgcaggagcagatcaagagtctcaagggtgagttccacttcgag
acctatatttcgctctcttgccacaactgcccggacgtggttcaggccctcaacctgatg
gccaccctgaaccctggcatcacccataccatgatcgacggcgccctgtttcaggaagaa
gtcaacgaacgccagatcatggcggtaccaaacgtctatctgaatggtcagccattcagc
cagggccgcatttcattggaagagatcgtcgccaagctcgacaccggcgccgccgagcgc
aaggccgccgaactgaatgagaaagatccctacgacgtgttggtggtgggcggtggcccg
gctggcgctgccgccgccatctatgccgcccgcaaaggcattcgcaccgccatcgttgcc
gagcgtttcggtggccaggtgatggacaccgtcggcatcgagaacttcatctccgtgccc
tacaccgagggccccaagctggccgccagcctggagcagcacgtcaagcagtacggggtg
gaagtgatcaccgagcagcgcgccgccgccatcagccgtgacggctatgtcaacgtggat
ctcgcctctggcgccaccttgaagagccgcgccgtgatcctggcgaccggtgcccgctgg
cgcgatctgaacgtgccgggagaactcgagtaccgcaccaagggcgtggcctactgcccc
cactgtgacggccccttcttcaagggcaagcgagttgcggtgatcggtggcggtaactcc
ggcatcgaggcagccatcgacttggccggcatcgtcgagcatgtcaccgtggtggagttc
gccgataccctgcgtgccgacgaggtattgcagaagaaggcccgctccatgagcaatatc
gacatcatcatgagcgcccgtaccaccgaggtgatcggtgacggcagcaaggtggtgggc
atggattacgaagatcgcaccaccggcgagatcaagcatctggcagtggccggtatcttc
gtccagatcggtctggtgccgaacaccgagttcctgaaaggaagtgaggtggccctgacc
cgctttggcgaaatagagatcgacaccaagggcgccacctccctgcccggcgtctacgcc
gcaggggatgccactactgtgccgttcaagcagatcatcatctccatgggggctggcgcc
accgccgcgctgggggcgtttgattacctcatccgcaacccggcaccggaagcggccaca
gccgaggccgacgcagtcatcgcctga

DBGET integrated database retrieval system