KEGG   Actinobacillus suis ATCC 33415: ASU1_06455
Entry
ASU1_06455        CDS       T03246                                 

Definition
(GenBank) hypothetical protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
ass  Actinobacillus suis ATCC 33415
Pathway
ass00230  Purine metabolism
ass00240  Pyrimidine metabolism
ass01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ass00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ASU1_06455
   00240 Pyrimidine metabolism
    ASU1_06455
Enzymes [BR:ass01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     ASU1_06455
    3.2.2.-  
     ASU1_06455
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: AIJ31554
LinkDB
Position
1423694..1425058
AA seq 454 aa
MAIHSVNPKGSLDQLSHLEMELLTKNAQGNLYSLYRNCSLAVLNSGAVTDDSRALLNQYQ
HFEINLITREKGVTLELHNPPETAFVDGKMMLNIQYHLFAVLRDIVFVNALSQYFKQDQP
QTDCRYITNQVFSILRNAKALEIGSDPNLIVCWGGHSINQTEYQYCRAVGTELGLRLLNI
VTGCGTGVMEALMKGAAIGHANQRYQNSRFIGITEPSIIASEPPNPIVNELIIMPDIEKR
LEAFVRMGHGIVIFPGGPGTLEELLYIIGIKLNPANKLQQLPVILTAPPESADYFTAIDE
FIGETLGKEAQQQYEIIIDDPVLVAQKMAHAMREVKRQRQALADSYSFNWLLKIDDAFIL
PFAPTHENMANLDLHFDQAPAQLAANLRRVFSGIVAGNIKPDTQDMIEQYGPFQLKGDRK
LMEKIDRLLQRFIQQHRMKLPTGEAYKPCYQIHK
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggccattcattcagtcaatccaaaaggcagtttagaccaactctcacatttagaaatg
gaattgctgaccaaaaatgcgcaaggcaatctctattctctttatcgcaactgttcgctt
gccgtactgaattccggtgcagtcaccgatgacagtcgtgcgctgctcaatcaatatcaa
cactttgaaatcaatctgattacccgtgaaaaaggggtgacacttgagctgcacaacccg
ccggaaaccgcttttgttgacggtaaaatgatgctcaatattcaatatcatctatttgcc
gtattacgtgacattgtttttgtaaacgccctttctcaatatttcaaacaagatcaaccg
caaaccgattgtcgctatatcaccaatcaagtcttttcaattttacgtaatgccaaagcg
cttgagattggttctgatccgaatctgattgtttgctggggcggtcattcaattaaccaa
actgaataccaatattgtcgagcagtcggcaccgaattggggctacgtttactcaatatc
gtcaccggctgcggtaccggtgtgatggaggcgctaatgaaaggcgctgcgattggtcat
gcgaaccagcgttatcagaatagccgttttatcggaatcaccgagccctctattattgcc
tccgagccgccgaatccgatcgtcaacgaattaatcattatgcccgatattgaaaaacgg
ttagaagcattcgtgcgaatgggacacggcattgtcatcttccccggcggccccggtaca
ttagaagaattgctttatatcatcggtataaaactcaatccggcaaataagttgcaacaa
ttaccggtaattttaaccgcaccaccggaaagtgccgattatttcaccgcaattgatgaa
tttataggagaaacgctcggtaaagaagcgcaacaacaatatgaaattatcattgatgat
ccggttttagtcgcccaaaaaatggcacatgcgatgagagaagtgaaacgtcagcgccaa
gcgctagccgattcatatagttttaactggttactgaaaattgatgatgcttttattttg
ccgtttgctccgactcacgaaaatatggcgaatcttgatctgcattttgaccaagctcca
gcgcaattagcggcgaatctacgccgtgtattttcgggtattgttgccggtaatatcaaa
ccagatacgcaagatatgattgagcaatacgggcctttccagctcaaaggcgatcgcaaa
ttaatggagaaaatcgaccgcttgttacaacgctttattcagcaacatcgtatgaaacta
ccgaccggagaggcttacaaaccttgttatcagattcataaatag

DBGET integrated database retrieval system