KEGG   Archaeoglobus sulfaticallidus: Asulf_02130Help
Entry
Asulf_02130       CDS       T02642                                 

Definition
(GenBank) Aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
ast  Archaeoglobus sulfaticallidus
Pathway
ast00030  Pentose phosphate pathway
ast01100  Metabolic pathways
ast01120  Microbial metabolism in diverse environments
ast01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ast00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Asulf_02130
Enzymes [BR:ast01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Asulf_02130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AGK62086
UniProt: N0BN87
LinkDB All DBs
Position
1929944..1931785
Genome map
AA seq 613 aa AA seqDB search
MGGYMGKILRVDLSSGTTKIEPISEEIARKYLGGKGYATYMIYQKLKSLEKEGIYPADID
PLGEFNDLIFATGPATGIAGFPEPGRYHVMTVRSPLTGSIGSANSGGKFGPYMKFAGFDI
IVVEGKSDKPVYLEVVDGSAEIKDASDLWGRNVFDTTRILSDRVGRRCSVACIGPAGENL
VLFANIMNDEHRAAGRTGVGAVMGSKKLKAIVCAGNTRPKPEDPEKFREESKKANDKIKQ
NPLTGEGLTKYGTAILVNVINNAGSLPFKNWQTGYNPEADKISGETLAEKYLIKNHGCWG
CTITCGRVTKVESGPYQILYSEGPEYESIWSLGNATGVTDLEAIIKANHFCDEYGLDTIS
MGSTIACAMELYEKGSIPEEYLQGVDLSFGNSSALVEMVWRTAFKAGFGKYLALGSKRLA
EMFGHPELSMSVKGLEMPAYDPRGIKGIGLTYATANRGGCHVTGYTVAPEIAGLPEKIDP
LTEEGKAQWVKAFQDFTCVVNSTVNCLFTTFAIGAEDFAPMLSAVTGWDFSVEELMKIGE
RIYNLERVIINKFGFDAKDDTLPPRLLKEALPEGAAKGHVVDLDKMKKEYYEIRGWVDGV
PTEEKLKELEIEL
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgggaggttacatgggaaaaattctaagagttgatctgtcctctggaacaacgaaaata
gagccaattagtgaagaaatcgcaaggaaataccttggtggaaagggttatgccacttac
atgatttatcagaagcttaaaagcctcgaaaaggagggaatttatcctgctgacatcgat
ccattaggcgaattcaacgatctgatttttgccaccggacctgcaacgggcattgcaggt
tttccagaacctgggagatatcatgtaatgactgtaagatccccgctgacaggttcgata
ggcagtgcaaactcaggcggtaagttcggcccgtacatgaagtttgccggctttgatatc
attgtcgttgaaggaaaatctgacaagccggtatatctggaggtcgtggacggttctgcc
gagattaaggacgcgtccgatctgtggggtagaaatgtattcgacacaaccagaatcctg
agcgacagggttggaagaagatgcagtgtcgcgtgcatagggcctgctggagagaatctc
gtgcttttcgcgaacataatgaacgatgaacatagggctgctggaagaactggggtcgga
gcggttatgggatcaaagaagctcaaagcaatagtatgtgctggaaacacaagaccgaag
ccagaggatccagagaaattcagggaagagtccaagaaagcaaacgataaaataaagcag
aatccactgacaggagagggattgaccaagtatgggacagcgattcttgttaatgtgata
aacaacgctggctctctaccattcaagaactggcagaccggatacaatccggaagcggat
aagatcagtggtgagacccttgccgagaaatacctgataaagaaccacggatgctgggga
tgcacgattacatgcggaagggtcaccaaggttgaaagcggaccgtatcagatcctttac
agcgagggtccagagtacgagtcaatatggtctctgggaaatgctactggtgtgactgac
ctagaagcgatcatcaaggccaaccacttctgcgatgaatacgggctggacacgatatcg
atgggttcaacaattgcatgtgcaatggagctttacgaaaaaggatcgattccagaggag
tacttgcagggagttgatctgagctttggaaactcttcagctttggttgagatggtctgg
aggacggccttcaaagcaggattcggaaagtatctcgcccttggatcaaagaggcttgct
gagatgttcggtcatcctgagctatcgatgagcgtcaaaggactggagatgccagcctat
gatccgaggggcatcaagggaattggtctgacctatgccacagcgaacagaggaggatgc
catgttaccggatacacggtagctcctgagattgctggattgcctgaaaaaatcgatccc
ctcacagaggaggggaaggcacagtgggtcaaggcattccaggacttcacctgtgtggtt
aactcaacggttaactgcctgttcacaacattcgcgattggagctgaggacttcgctcca
atgctttctgcagtaaccggatgggacttcagcgttgaagaactcatgaagattggagag
agaatatacaacctcgagagggtcatcatcaacaagttcgggttcgatgccaaagatgat
acactgcctccaaggctcctgaaagaggctctgccagagggtgctgccaagggacatgtt
gtcgatctcgataagatgaagaaggagtactacgagattagaggatgggttgatggagtt
ccaacggaagaaaagttgaaggagcttgagattgaactataa

DBGET integrated database retrieval system