KEGG   Archaeoglobus sulfaticallidus: Asulf_02177Help
Entry
Asulf_02177       CDS       T02642                                 

Definition
(GenBank) RNA ligase, Pab1020 family
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
ast  Archaeoglobus sulfaticallidus
Brite
Enzymes [BR:ast01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Asulf_02177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AGK62130
UniProt: N0BP55
LinkDB All DBs
Position
complement(1972249..1973391)
Genome map
AA seq 380 aa AA seqDB search
MKFVAEALHLSPPAAKRLEERNLLREAFVKHSFFHDIVSAYKLEKKFGGFEEGTLIAKTK
HGLEVVRGYPKIRRALTLHPTIKKHFRDEVVVEEKMNGYNVRIVNFGSNLYAITRRGFIC
PYTTEKAREMIDSSFFRHYPELMLCCEVVGKESPFVVKDIYGTDLDFYIFDVREKRSNRS
LSIDNKMKIAEEYGFKLAPILERCDTNVAHEVCRDIIERIGNEGREGIVLKDPEMKINPI
KYTTSESNATDLYFAFRYFNDYGKDFMLSRLVREAFQSFEFNENESKFKERCERIGKAIL
ESMIKSVIDVSCGREVSEHHRLRFSSLEVLELFKVHLIRMGVDVRFSDPYHDGEKYVLEF
RRIMRSTTDKISHHLKGNLW
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcgttgcggaagctttacacctgtctcctccagctgcgaaaaggctggaggag
agaaacctcctgagagaagcttttgttaaacactctttttttcatgatatcgtctctgca
tacaagctcgagaaaaagtttggtggatttgaagagggtacgcttatagcaaaaacaaag
catggtttggaagtagtcagaggatatccgaagataaggagggctttaacacttcatcca
acaataaaaaagcatttcagggatgaggtggttgttgaggaaaagatgaacgggtataat
gtaaggattgttaactttggcagcaatctatatgcaataacgagaaggggtttcatctgt
ccatatactacagaaaaagcgagggagatgattgacagctcttttttcagacattatcca
gaactcatgctttgctgtgaggttgtgggtaaagagtccccatttgtggttaaggacatc
tacggcaccgatctggacttttatatatttgatgtgagggagaaaaggtctaacagatct
ctatcaattgataataaaatgaaaattgcagaggagtatgggtttaaattagctccgatt
ctggagagatgtgatacaaatgtagctcatgaggtttgcagagatattattgagcgaata
gggaacgagggtagagaggggatagttttaaaggatcctgaaatgaagataaatccgata
aaatatacaacaagtgaatccaatgccacggatttatactttgctttcagatacttcaac
gactatggaaaggatttcatgctttcaagacttgtaagggaagcgtttcagagcttcgaa
tttaatgaaaacgaaagcaaattcaaagaaaggtgtgaaaggataggaaaggcaattctg
gaatctatgattaaaagcgtaattgatgtcagttgcggaagggaagtctctgaacatcac
agactgagattcagcagccttgaagtacttgaactcttcaaggtacatctgattaggatg
ggtgttgatgtcaggttcagcgatccataccacgatggcgaaaagtatgttctcgaattc
agaaggatcatgcgaagcacgacagataaaatatcacaccatttgaagggaaacctctgg
tag

DBGET integrated database retrieval system