KEGG   Actinobacillus succinogenes: Asuc_0094Help
Entry
Asuc_0094         CDS       T00558                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
asu  Actinobacillus succinogenes
Brite
KEGG Orthology (KO) [BR:asu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:asu03012]
    Asuc_0094
   03029 Mitochondrial biogenesis [BR:asu03029]
    Asuc_0094
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asu04147]
    Asuc_0094
Translation factors [BR:asu03012]
 Eukaryotic Type
  Elongation factors
   Asuc_0094
 Prokaryotic Type
   Asuc_0094
Mitochondrial biogenesis [BR:asu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Asuc_0094
Exosome [BR:asu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Asuc_0094
  Exosomal proteins of breast cancer cells
   Asuc_0094
  Exosomal proteins of colorectal cancer cells
   Asuc_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ABR73474
UniProt: A6VKH7
LinkDB All DBs
Position
complement(110602..111786)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSKHYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLTQYDFPGDDTPIIRGSALKALE
GEAEWEEKILELANALDSYIPEPERAIDQPFLLPIEDVFSISGRGTVVTGRVERGIIRTG
DEVEIVGIKDTTKTTVTGVEMFRKLLDEGRAGENIGALLRGTKREEIERGQVLAKPGSIT
PHTDFVSEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNVKMT
VSLIHPIAMDQGLRFAIREGGRTVGAGVVASVIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgtaaacgtgggtacaatcggccac
gttgaccacggtaaaacaactttaacagcagcaatcaccacagtattatccaaacactac
ggcggtgcggctcgcgcattcgaccaaatcgataacgcgccggaagaaaaagcgcgtggt
atcaccatcaacacatcacacgttgaatacgatacgccgacccgtcactatgctcacgtt
gactgcccgggacacgcggactatgtgaaaaacatgatcaccggtgcggcacaaatggac
ggcgcaatcttagtggtagcggcaacagacggtcctatgccgcaaacccgtgagcacatc
ttattaggtcgccaggtaggcgtaccgtacatcatcgtattcttaaacaaatgcgacatg
gtggatgacgaagaattattggaattagttgaaatggaagttcgcgaacttctgacccaa
tatgatttcccgggcgatgacacgccaatcattcgtggttccgcattaaaagcgttggaa
ggcgaagcggaatgggaagaaaaaattcttgaattggcgaacgctctggatagctatatt
ccggaacctgaacgtgcgattgaccaaccgttcttattaccgattgaagacgtattctca
atctcaggccgtggtacggtagtcaccggtcgtgtagaacgcggcatcatccgtaccggt
gacgaagtagaaatcgtcggtatcaaagatacgacgaaaactaccgtaaccggagttgaa
atgttccgtaaattactggacgaaggtcgtgcgggtgaaaacatcggtgcgttattacgc
ggtaccaaacgtgaagaaatcgaacgcggtcaagtattggcgaaaccgggttcaatcaca
ccgcacacagacttcgtatcggaagtgtacgtattgtcaaaagaagaaggcggtcgtcat
actccgttcttcaaaggttaccgtccgcagttctatttccgtacgactgacgtaacgggt
acaatcgaattaccggaaggcgtagaaatggttatgcctggcgataacgtaaaaatgacg
gtaagcttaatccatccgattgcgatggaccagggtttacgtttcgcaatccgcgaaggc
ggccgtacggtaggcgccggcgtggtagcgagcgtaatcaaataa

DBGET integrated database retrieval system