KEGG   Actinobacillus succinogenes: Asuc_0159Help
Entry
Asuc_0159         CDS       T00558                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K23007  L-galactonate 5-dehydrogenase [EC:1.1.1.414]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00053  Ascorbate and aldarate metabolism
asu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Asuc_0159
Enzymes [BR:asu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.414  L-galactonate 5-dehydrogenase
     Asuc_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C 3HCDH_N FAD_binding_3 ADH_zinc_N_2 Pyr_redox_2 Sacchrp_dh_NADP FAD_binding_2 HI0933_like 2-Hacid_dh_C adh_short_C2 NAD_binding_7 Pyr_redox Thi4 FAD_oxidored TrkA_N DapB_N NADH_4Fe-4S Shikimate_DH UDPG_MGDP_dh_N Pyr_redox_3 NAD_binding_8 adh_short AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ABR73539
UniProt: A6VKP2
LinkDB All DBs
Position
complement(188565..189569)
Genome map
AA seq 334 aa AA seqDB search
MKSLVCKEPFKLVLEEREKPQPKENEVQLKIAAIGICGTDIHAYAGNQPFFEYPRVLGHE
ASGVITDLGKNVDKFKVGQRVALIPYVSCGKCGACLSGKTNCCEKISVIGVHQDGAFSEY
LVAPAQNILPVSDNVNDVTAALIEPYAISAHAVRRAQINVGDDVLVVGAGPIGLGAAAIA
HADGANVVIADTSEERRKHIQANIPVPTLDPINEKVEDYFNGRLPEIVIDATGNQRAMNN
AVNLIRHGGRIVFVGLHKGSIEFSDPDFHKKETTLMGSRNATLEDFEKVQRLMAEGKIAA
NMMLTHTFKYDGLADIYEEEITKNKSLIKSVILY
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcactagtatgtaaagaaccgtttaaacttgttttagaggaaagagaaaagccg
caaccaaaagaaaatgaagtgcaattgaaaattgcagcgattggtatttgtggtacggat
attcatgcttatgccggtaatcaaccattctttgaatacccgcgtgtattaggacatgag
gcaagcggtgtgataacggatttaggtaaaaatgtagataaattcaaagtaggtcaacgg
gtggcattaatcccttatgtttcctgtggtaagtgcggggcatgtttaagcggtaaaacg
aattgttgtgagaaaatttcggttatcggcgttcatcaagacggcgcatttagtgagtat
ctcgttgcacccgctcaaaatattttacccgtttctgacaatgttaatgatgttactgct
gcgctaatcgaaccttatgctattagtgcacatgcagtaagacgcgcacaaataaacgtt
ggggatgatgttttagtcgtgggagccggtcctattggacttggcgccgccgcgattgct
catgccgatggcgcaaatgtcgtgattgctgatacgagtgaagaacgacgtaaacatatt
caggcaaatattccggtacctacattggatcctattaatgaaaaagtagaagattatttt
aacggtcgtttacctgaaattgttattgatgcgacaggtaatcaaagggcaatgaacaat
gcggtaaatttaatccgtcatggcggtcggatcgtatttgtcggtttacataaaggctca
attgagtttagtgatcctgatttccataaaaaagaaaccactcttatggggagccgtaat
gcgacattagaagattttgagaaagtacagcggttaatggctgaaggcaaaattgcagcg
aatatgatgctgactcatacattcaaatatgatggattagcggatatttatgaggaagag
attaccaagaataaatcgttaattaaatctgttattttatattag

DBGET integrated database retrieval system