KEGG   Actinobacillus succinogenes: Asuc_0171Help
Entry
Asuc_0171         CDS       T00558                                 

Definition
(GenBank) Transketolase domain protein
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00030  Pentose phosphate pathway
asu01100  Metabolic pathways
asu01110  Biosynthesis of secondary metabolites
asu01120  Microbial metabolism in diverse environments
asu01130  Biosynthesis of antibiotics
asu01200  Carbon metabolism
asu01230  Biosynthesis of amino acids
Module
asu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
asu_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:asu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Asuc_0171
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Asuc_0171
Enzymes [BR:asu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Asuc_0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N DXP_synthase_N TPP_enzyme_C E1_dh
Motif
Other DBs
NCBI-ProteinID: ABR73551
UniProt: A6VKQ4
LinkDB All DBs
Position
complement(203458..204288)
Genome map
AA seq 276 aa AA seqDB search
MNPYNLSYDELEKKAKAIRRKIVVLNANSPAGGHTGADLSQVEILTSLYFRVLNNDPKDL
INPERDIYIQSKGHGAGGYYCCLAEAGYIPEDWLPTYQHSDSKLPGHPVKHKTPGVELNT
GALGHGLPVAVGLAIAAKKSGSKRKIYVLTGDGELGEGSNWEAALTAAQYKLDNLIIIND
KNKLQLAGFTKDILCTDPLDKKWEAFGMEVHECQGNDIRSVVDTLESIQPNGKPHVVIAN
TTKGAGISFIEGRPEWHHKVPKGDEVELALEELKDE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtataatttgtcctatgatgagttagaaaaaaaagccaaagcaattcgtcgg
aaaatcgtcgtattaaatgctaacagtcctgctggtggtcatacaggcgcagatttatct
caagtagaaatcttaacttcattgtacttccgtgtattaaataatgatccaaaagattta
attaacccagagcgtgatatttatattcagtctaaaggtcatggtgcaggtggttattat
tgctgtttagccgaggcaggctatattcctgaagactggttaccaacctatcaacattca
gattcaaaacttccaggccacccagtaaaacataaaacacctggtgtggaattaaatacg
ggggctttaggtcatggtttacctgtggctgtcggtttagccattgccgctaaaaaaagc
ggtagtaaacgtaaaatctatgtgttaacgggggatggcgaacttggcgagggtagtaac
tgggaagctgcattgactgcggcacaatataaattagacaaccttattattattaatgat
aaaaataaattacaacttgctggttttactaaagatattttatgtactgatccattagat
aaaaaatgggaagcgtttggtatggaagtgcatgaatgccaaggtaatgatattcgttca
gtcgtagataccttagaaagcattcagccaaatggcaaaccacatgtagttattgctaat
actacgaaaggtgcaggtatttcatttattgaaggtcgtccagaatggcatcacaaagta
ccgaaaggcgatgaagttgaattagcattagaggagttgaaagatgagtaa

DBGET integrated database retrieval system