KEGG   Actinobacillus succinogenes: Asuc_0205Help
Entry
Asuc_0205         CDS       T00558                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00564  Glycerophospholipid metabolism
asu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Asuc_0205
Enzymes [BR:asu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Asuc_0205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 DAO_C FAD_binding_3 FAD_oxidored Thi4 Pyr_redox_2 NAD_binding_8 HI0933_like 3HCDH_N Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ABR73585
UniProt: A6VKT8
LinkDB All DBs
Position
complement(240503..242182)
Genome map
AA seq 559 aa AA seqDB search
MAMSSLYQNAGDFSPVSTDVIIIGGGATGAGIARDCALRGLKCILLERRDIATGATGRNH
GLLHSGGRYAVNDRESAEECIKENLILKNIARHCVDDTKGLFITLPEDDLNYQKTFIEAC
TASGIEAVAIDPALARHMEPSVNPDLVGAVVVPDGSIDPFRLTAANMIDATERGAQVFTY
CEVTGLIREGDKVIGVDVYDHKNALKRRFFAPIVVNAGGIWGQGIAEYADLKIRMFPAKG
ALLVMGHRINKLVINRCRKPADADILVPGDTICVIGTTSSRIPYDQIDNMEVTPEEVDIL
FREGEKLAPSLRHTRVLRAYAGVRPLVASDDDPSGRNVSRGIVLLDHAERDGLDGFVTIT
GGKLMTYRLMAEWATDLVCKKLNVNKKCETADRTLPGSEESRDEINKKIINIPKTISSSA
VYRHGTRAKPMLENERLDRSLVCECEAVTAGEVRYAVDNLNINNLVDLRRRTRVGMGTCQ
AELCACRAAGLMARFDVATARQSTLQLASFMEERWKGIQPIAWGDAMRESEFTGWIYYSL
LGLNDVRPQAVEGVNNNEF
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgtcgtctctttatcaaaatgcaggtgatttttcgcctgtcagtacggacgta
attattatcggcggcggcgctaccggtgcagggattgcgcgcgactgcgcattgcgagga
ttaaaatgtattctgctggaacgccgcgatattgcaacgggcgcaacggggcgaaaccac
ggtttactgcatagcggcggacgttatgccgtgaacgatcgcgaatccgctgaagaatgt
attaaagaaaaccttattctaaaaaacattgcccgtcattgcgtggatgatactaagggc
ctgtttatcacgttgcctgaagacgatttgaattatcagaaaacctttatcgaagcctgt
accgcatcgggcattgaagcggtagctatcgatcccgctttggcgcgtcatatggaaccg
tcggtgaatccggatttggtgggggcagtggtcgtaccggacggttctatcgatccgttc
cgtttaaccgctgccaatatgattgacgccactgaacgcggcgcacaggtttttacctat
tgtgaagtgaccggactgattcgcgaaggcgacaaagttatcggggtcgatgtgtatgat
cataaaaatgcgctgaaacgccgattttttgcgccgatagtggtgaatgccggcggaatc
tgggggcagggtatcgctgaatatgccgatttaaaaatcagaatgtttccggcaaaaggc
gcattgttggtgatgggacatcgaattaataaattggttattaatcgctgccgtaagccg
gcggatgcggatattttagtgccgggcgatactatttgcgtcatcggtacgacatccagc
cgtattccttacgatcaaatcgataacatggaagtgacgccggaagaagtggatatttta
ttccgcgaaggagagaaactggcgccgagtttgcgtcatacccgagtactgcgcgcttat
gccggcgtgcgcccgctggtggcaagcgacgacgatccctccggccgtaatgtaagccgc
ggtatcgtattgctggatcatgccgaacgcgacggtttggacggtttcgtaaccatcacc
ggcggcaagctgatgacttatcgcttaatggcggaatgggcgacggatttagtgtgtaaa
aaacttaacgtcaacaaaaaatgcgaaacggccgaccgcactttgccggggtcggaagag
tcccgcgatgaaattaacaagaaaatcatcaacattccgaaaaccatcagtagttccgcc
gtataccgtcacggtacccgcgccaaaccgatgctcgagaacgaacgcttagaccgttcc
cttgtatgcgaatgtgaagcggtgacagccggagaggtccgttatgcggtggataactta
aatattaataatctggtggatttacgccgtcgcacccgggtaggcatgggcacctgtcag
gcggaattatgcgcttgccgggcggcggggctcatggcgcgtttcgatgtcgcgacagcg
cgtcagtccactttgcaattagcctcatttatggaagaaagatggaaaggaatccaacct
atcgcctggggtgacgccatgcgcgaatcggaatttaccggctggatttactacagtttg
ctgggtttgaacgatgtacgaccgcaagctgtggaaggagtgaataataatgaattttga

DBGET integrated database retrieval system