KEGG   Actinobacillus succinogenes: Asuc_0264Help
Entry
Asuc_0264         CDS       T00558                                 

Definition
(GenBank) Shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
asu  Actinobacillus succinogenes
Pathway
asu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
asu01100  Metabolic pathways
asu01110  Biosynthesis of secondary metabolites
asu01130  Biosynthesis of antibiotics
asu01230  Biosynthesis of amino acids
Module
asu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:asu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Asuc_0264
Enzymes [BR:asu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Asuc_0264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 Cytidylate_kin2 AAA_18 Cytidylate_kin dNK AAA TsaE AAA_17 AAA_16 AAA_22 AAA_24 ABC_tran AAA_5 AAA_28 AAA_7 CoaE RNA_helicase APS_kinase His_biosynth Ploopntkinase3 AAA_29 AAA_PrkA AAA_25 RuvB_N IstB_IS21 Guanylate_kin Mg_chelatase Rad17
Motif
Other DBs
NCBI-ProteinID: ABR73643
UniProt: A6VKZ6
LinkDB All DBs
Position
complement(297707..298234)
Genome map
AA seq 175 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLGMEFFDSDSVIEERAGAEISWIFDIEGENGFR
KREERIINELTQKQGIVLSTGGGVVLSKENRNHLSARGIVVYLQTTVAKQFERTQRDKKR
PLLQGVEDARQVLENLAVIRNPLYEEVADITLPTDEQSAKVMANQIIDLIDNFHG
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaacgtaatatatttttagtcggtcctatgggggcaggtaaaagcaccatc
ggacgtcagttagctcaacagctcggcatggaattttttgattccgacagcgtcattgag
gaacgcgccggcgcagaaatcagctggattttcgatattgaaggagaaaacggtttccgc
aaacgcgaagaacgaataatcaacgaattaacccaaaaacaaggaattgtgctgtccacc
ggcggcggagtcgtcttgtcaaaagaaaaccgaaatcatttatccgcccgcggtattgtg
gtgtatttacaaactacggtggcaaaacaattcgagcgcacgcaacgtgataaaaaacgc
ccgttattgcaaggcgtcgaagatgcacgccaagtgttggaaaacttagccgtcatccgt
aatccgctgtatgaagaagtcgcggatattaccctgccgaccgatgaacaaagcgcaaaa
gtcatggcaaatcaaattattgatttaattgataatttccatggataa

DBGET integrated database retrieval system