KEGG   Actinobacillus succinogenes: Asuc_0800Help
Entry
Asuc_0800         CDS       T00558                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
asu  Actinobacillus succinogenes
Brite
Enzymes [BR:asu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Asuc_0800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ABR74170
UniProt: A6VMH3
LinkDB All DBs
Position
858090..858656
Genome map
AA seq 188 aa AA seqDB search
MRKTLLALGLATLGISAASNAAENGHQHTAPSVENLTVDVQLLDPVKGDQSVGKVVITES
PYGLVFTPELKGLSAGLHGFHIHENPSCEPKEKDGKLTAGLAAGGHWDPNKAEGHGYPWA
DDAHLGDLPALYADADGNAFNPVLAPRLKTLTEIKGRSLMIHAGGDNHSDHPQPLGGGGA
RMACGVIK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaacattattagcattaggtttagcaacattaggcatttccgctgcgtcgaat
gcggcggaaaacggacatcaacatacggcgccatccgtcgagaatttaaccgttgatgtg
caattattggatccggtgaaaggcgatcagtccgtggggaaagtagtgatcaccgaatcg
ccttacggattggtctttacgccggaattgaagggactttccgcaggattacacggtttt
catattcatgaaaatccgagttgcgagccgaaagaaaaagacggtaaactgacggccggc
ttggcggcgggcggtcactgggatccgaacaaagcggaaggacacggttatccttgggct
gacgacgctcacttaggcgatttgccggcactttatgcggatgcggacggtaatgcattt
aatccggttctggcgccgcgtttgaaaacattaaccgaaatcaaaggtcgttctttaatg
attcatgccggcggcgacaatcattccgatcatccgcagccgttgggcggcggcggtgcc
agaatggcttgtggtgtaattaaatag

DBGET integrated database retrieval system