KEGG   Acetobacter oryzifermentans: WG31_06285Help
Entry
WG31_06285        CDS       T04478                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
asv  Acetobacter oryzifermentans
Pathway
asv00061  Fatty acid biosynthesis
asv00780  Biotin metabolism
asv01100  Metabolic pathways
asv01130  Biosynthesis of antibiotics
asv01212  Fatty acid metabolism
Module
asv_M00083  Fatty acid biosynthesis, elongation
asv_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:asv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    WG31_06285
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    WG31_06285
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    WG31_06285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:asv01004]
    WG31_06285
Enzymes [BR:asv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     WG31_06285
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     WG31_06285
Lipid biosynthesis proteins [BR:asv01004]
 Fatty acid synthase
  Component type
   WG31_06285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ANA13671
UniProt: A0A160BKI5
LinkDB All DBs
Position
1299416..1300255
Genome map
AA seq 279 aa AA seqDB search
MSSPNATLPAQGTLMKGKKGLVMGVANDRSIAWGIASAVAAQGGELAFTYQGEALGKRVQ
PLAESVGSSLVLPCDVTDDAAIDATFATIEKEWGELDFVVHAIGWADKQFLRGRYVDTPR
EAFLKALDISCYSFTAVAQRASKLMKNGGSLLTLSYLGAERVMPHYNVMGVAKAALEASV
RYMATDLGRDGIRVNAISAGPIKTLAANGIGDFRYILKWNQYNSPLERNVALEEVGGAGL
YMVSDLSTGVTGEVHHVDCGYHVVGMKNPTAPDISVAGD
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctcccaacgccacattgcctgctcagggaacgcttatgaagggcaagaagggt
ctggtaatgggtgtcgctaatgatcgttccattgcatggggcattgcctccgccgttgcg
gcacagggtggggagcttgcatttacgtatcagggcgaagctctgggcaagcgcgtgcag
cctctggcagaaagcgtaggctccagcctggttctgccctgcgatgtgacagatgacgcc
gccattgatgctacttttgccaccattgaaaaagaatggggtgaactggactttgtggtg
cacgccattggctgggcagacaagcagttcctgcgtgggcggtatgttgataccccgcgt
gaagcgtttttgaaggcgctggatatttcctgctattcctttacggcggttgcgcagcgc
gcctccaagctgatgaaaaatggcggttctttgcttaccctgagttatctgggggcagaa
cgtgtcatgccgcattataatgttatgggtgttgcaaaagctgcgctggaagcctcggtg
cgttatatggcaacagatctggggcgtgatggtatccgtgtgaacgccatttctgctggc
ccgatcaaaacccttgctgccaatggcattggggatttccgctacattctgaagtggaac
cagtacaactctccgctggaacgcaatgtggcgttggaagaagtgggtggcgctggcctg
tatatggtgtctgatctttcaaccggcgtaacgggtgaagtgcaccatgtggattgtggt
taccatgttgtgggcatgaaaaacccaactgcccctgatatttctgtagctggggactga

DBGET integrated database retrieval system