KEGG   Acetobacter oryzifermentans: WG31_12545Help
Entry
WG31_12545        CDS       T04478                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
asv  Acetobacter oryzifermentans
Pathway
asv00250  Alanine, aspartate and glutamate metabolism
asv00280  Valine, leucine and isoleucine degradation
asv00410  beta-Alanine metabolism
asv00640  Propanoate metabolism
asv00650  Butanoate metabolism
asv01100  Metabolic pathways
asv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:asv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    WG31_12545
   00650 Butanoate metabolism
    WG31_12545
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WG31_12545
   00280 Valine, leucine and isoleucine degradation
    WG31_12545
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WG31_12545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:asv01007]
    WG31_12545
Enzymes [BR:asv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     WG31_12545
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     WG31_12545
Amino acid related enzymes [BR:asv01007]
 Aminotransferase (transaminase)
  Class III
   WG31_12545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ANA14703
UniProt: A0A160BP92
LinkDB All DBs
Position
2657059..2658345
Genome map
AA seq 428 aa AA seqDB search
MATNKDLLNRRTHAVPRGVATSTPVFADRAENAELWDVEGKRYVDFAGGIAVLNVGHRHP
KVMDAVKKQLDRFTHTAFQVSAYEPYIELAEKLNARAPFSGDAKTIFFTTGGEATENAVK
IARAATGRNGVIAFCGGFHGRTLLASALTGKVLPYKAPFGTLPGEVYHIPFPDNHDITVE
DSLKMLNFLFAADISPNNVAAIIIEPVQGEGGFRVAPTALLKQLRAICDQHGIKLIADEV
QSGFARTGKLFGIEHSGVEPDLVCIAKSLAGGFPLSGVIGRAELMDSVPPGGLGGTYAGA
PLGCAAGLAVLDIIEEEKLLDRANNMGERLKARIASWHKRTDMLPISMPRGLGAMVAFDI
LERHAGVEQRKGFGSKLCARACEKGLILLACGVQGATIRILTPLTASDELVDEGLDIIEQ
ILLEEAKA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccacgaataaagaccttctgaaccgccgcacccatgctgtgccacgcggtgttgcc
acctccacccccgtttttgcagatcgcgcagaaaatgctgaactatgggatgtggaaggc
aaacgctatgttgattttgcaggcggcattgccgttctgaacgttggccaccgccaccca
aaagtgatggatgctgttaaaaagcagctagatcgctttacccacacagcttttcaggtt
tctgcttacgagccctatattgagctggccgaaaagctgaacgcccgcgccccgttttct
ggcgatgctaaaaccattttcttcaccacgggtggagaagcaacagaaaacgccgtaaaa
attgctcgcgctgcaacaggccgtaacggtgtcattgcgttctgcggtggcttccatggc
cgcacactgttagcttctgcgcttacgggtaaagtactgccttacaaagcaccttttggc
acgctacccggtgaagtgtaccacatccccttccccgataatcatgacatcacggtggaa
gacagcttgaaaatgctgaacttcctatttgcggctgatatctcccccaacaatgtagct
gctattattattgagcccgtgcagggggaaggtggcttccgggttgcccctacagcactg
ctcaagcagctccgcgctatttgtgaccagcacggcatcaaactgattgccgacgaagtg
cagagtggttttgcccgtactggcaagctgtttggaattgaacattccggcgtagaacca
gatctggtgtgcattgctaaatctctggcaggtggttttccgctttccggtgtgattggc
cgtgcagaactgatggattctgttcctccaggtggtttgggcggcacatatgcaggtgcc
cctctgggttgtgcagcaggtttggccgtgctggacattattgaggaagaaaagctgctt
gaccgtgccaataacatgggtgaacgcctgaaggcccgtattgcaagctggcataagcgc
acagatatgctgcctatcagcatgccgcgtgggctgggcgcaatggttgcttttgatatt
ctggaacgccatgcgggtgtggaacagcgcaagggctttggttccaaactgtgtgcccgc
gcctgtgaaaaaggtctgattttgctggcatgtggtgtgcagggcgcaacaatccgtatt
ctgacaccgctgaccgcatctgatgaactggttgatgagggtctggatattatcgaacaa
attctactggaagaagcaaaagcctga

DBGET integrated database retrieval system