KEGG   Achromobacter spanius: CVS48_00640
Entry
CVS48_00640       CDS       T05274                                 

Definition
(GenBank) TIGR03756 family integrating conjugative element protein
Organism
asw  Achromobacter spanius
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-ProteinID: AUA54661
LinkDB
Position
complement(131238..132188)
AA seq 316 aa
MTHRPFDLLRRLRVAVASLLLISATGSYALNTATIVSSVMSPDCLEYRVVGICYWLYCTW
TGCTVRTSTKVRHYVPDAVVSSYSNTGENPWVEVQAMSTPNPSAQAGGDGTTNEDHENNL
AKFKNSDVIGHPGGEVFNQFASSSGYFCQGAGTAFMPYLLSTLDTLAWRYNVPEMAYPEA
LIPGMREVGARTTMNLWGNVYPRGGFLHQTDDYKSGAVVAQRAGDVVTRRGQIHVYQPLL
ANARDGYWPAGALMEGDASTGKWQELTPRLSNTCVVFPHSGTLTQAQQGDYAWALWRPYA
CCERRGQVFLGSVDFL
NT seq 951 nt   +upstreamnt  +downstreamnt
gtgacccatcgcccattcgacctgctgcgccgcctgcgcgtcgccgtggcctcgctgctg
ctgatcagcgccacgggcagctacgccttgaacaccgccaccatcgtgtcctccgtcatg
tcgccggactgcctggagtaccgggtggtgggcatctgctactggctctactgcacctgg
acgggctgcacggtgcgcacatccaccaaggtccggcactacgtgcccgatgcggtcgtc
tccagctacagcaacaccggagagaacccctgggtcgaggtgcaggcgatgagcacgccc
aacccatccgcacaggcaggtggggatgggaccacgaacgaagaccacgaaaacaacctc
gccaaattcaagaacagcgatgtcatcggccatcctggcggcgaggtattcaaccagttc
gcatcgtcgtcgggctatttctgccaaggcgcgggcacggccttcatgccgtatctactc
agcaccctggacacgctggcttggcgctacaacgtgcctgaaatggcctacccggaggcg
ttgattccgggcatgcgcgaggtcggtgcgcgcaccacgatgaacctctggggcaatgtc
tatccgcgcggcggcttcctgcatcagaccgatgactacaaatccggggccgtcgtggcc
cagcgcgccggtgatgtcgtcacgcgccgcgggcagatccacgtgtaccagccgctgctt
gccaacgcccgcgacggctactggccggccggcgcgctgatggagggtgatgcctctacg
ggcaagtggcaggagctgacgccgcgcctgtccaacacctgcgtggtgttcccgcacagc
ggcacgctgacccaggcccaacaaggcgactacgcctgggcgctgtggcgtccctatgcg
tgctgcgaacgccgcgggcaggtgttcctgggcagcgtcgatttcctctga

DBGET integrated database retrieval system