KEGG   Achromobacter spanius: CVS48_03655Help
Entry
CVS48_03655       CDS       T05274                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
asw  Achromobacter spanius
Brite
KEGG Orthology (KO) [BR:asw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CVS48_03655
Enzymes [BR:asw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     CVS48_03655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Methyltransf_25 Pyr_redox_2 ThiF ADH_zinc_N_2 TrkA_N DUF43 Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AUA55207
UniProt: A0A3S4RRX7
LinkDB All DBs
Position
complement(792085..793122)
Genome map
AA seq 345 aa AA seqDB search
MLNCAIHGAQDLRLTEQAPEPLGATQVRVGIKAVGICGSDLHYYRHGKVGDFVIREPLTP
GHEAAGQVLEVGAAVTSVKPGDRVALDPARTCGVCRYCRQGDSNHCEAVHFFGSASKYPH
MQGAMREQVVVEARQCLPVPDGLSFELAAFGEPLAVALHAVRSAGSLLGKSVMVVGAGPI
GALTLMAARLAGASQVTVVDIVDETLATCARVGATRTINAATDPAAIDALAAGKGTIDVC
FEASGNYAGLANCIRATRPRGVIVTVGTLNGSSEQCPFNQIMVKSLSVIGSFRFVDEYAW
AVDYLSRGVLDVSPLLTAAVPVQNVHAAFALAADRHQAMKVMVTF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgttgaattgcgcgattcacggggcccaggacctgcgcctgaccgaacaggcgcccgag
ccgttgggcgcgacacaggtgcgggtgggcatcaaggccgtgggcatctgcgggtccgac
ctgcattactaccgacacggcaaggtgggcgacttcgtcatccgcgaaccgctgacgccg
gggcacgaggcggccggccaggtgctggaggtgggcgcggccgttaccagcgtcaagccg
ggcgaccgcgtggcgctggaccccgcgcgcacctgcggcgtgtgccgctattgccgccag
ggcgattccaaccattgcgaagcagtgcatttttttggcagcgccagcaagtatccgcac
atgcagggcgcaatgcgcgagcaggtagtggtagaggccaggcagtgcctgccggtgcca
gacggcctgtcgttcgaactggccgcctttggcgaaccgctggccgtggcgctgcacgcg
gtgcgcagtgccggcagcctgctgggcaagtcggtgatggtggtgggcgccggccccatc
ggcgcgctgaccttgatggcggcgcggctggcgggcgccagccaggtgacggtggtggac
atcgtggacgaaacgctggccacctgcgcgcgcgtgggcgccacccgcaccatcaacgcc
gccaccgaccccgccgccatcgatgcgctggcggcgggcaagggcaccatcgacgtgtgc
ttcgaagcgtcgggcaattacgccgggctggccaactgcatacgcgccacgcgcccgcgc
ggcgtgatcgtcaccgtgggcaccttgaatggcagcagcgaacagtgccccttcaaccag
atcatggtcaagagcctgtcggtgatcggcagcttccgctttgtcgacgaatacgcctgg
gccgtggattacctgagccgtggcgtgctggacgtgtcgcccctgttgacggcggcggtg
ccggtgcagaacgtgcatgccgcgttcgcgctggcggccgaccggcatcaggcaatgaaa
gtgatggtgacgttctga

DBGET integrated database retrieval system