KEGG   Achromobacter spanius: CVS48_09230Help
Entry
CVS48_09230       CDS       T05274                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
asw  Achromobacter spanius
Pathway
asw00620  Pyruvate metabolism
asw00680  Methane metabolism
asw01100  Metabolic pathways
asw01120  Microbial metabolism in diverse environments
asw01200  Carbon metabolism
Module
asw_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:asw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CVS48_09230
  Energy metabolism
   00680 Methane metabolism
    CVS48_09230
Enzymes [BR:asw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CVS48_09230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AUA56200
UniProt: A0A2K8S0S6
LinkDB All DBs
Position
complement(2021434..2024283)
Genome map
AA seq 949 aa AA seqDB search
MKAIRPQSDSAEPLRHDIRLLGRFLGAVIEECEGKRVFDTIETLRRTAVKFRREGNEADS
KLLEQRVKRLQGNDPNSVARAFSYFLHLANIAEDRDQNRNQRARALAGDTAPRGSLRDAV
QTLGKQGVGVARIRRLLADASVVPVLTAHPTEVQRKSTLDVHREIAAALTQRGNPLTPEE
LAELDAALLGRVATLWQTRMLRYTRLTVADEIENALSYYRSTFLQVIPRLYADLSKLLNR
ETAKPFAAPPPPLEPFLRMGSWIGGDRDGNPNVDASTLERALLRQATVLFEHYLQEVHAL
GAELSITTMLISADPELLALADNSGDDSPHRRDEPYRRALVGVYARLAATAQALTGQNLA
RRSTVAAPAYQAPQELSTDLAIIAASLAAHHGSPLAKLRLSGLQQAIEVFGFHLATVDLR
QSSDVHENALAELFERAGVQHDGKPLDYLSLDEDQRVALLRAELAQARPLASPWIAYSED
TTRELAVLRAAAAGRARYGKQAVRQTIVSHTETLSDLLEVMVLQKEAGLIAPAGQDIAPE
DGLMVVPLFETIPDLQRGADIMAAWLDLPEVRQRVKQAQNGAQEVMLGYSDSNKDGGFLT
SNWSLYQAERALVDVFSARNVRLRLFHGRGGSVGRGGGSSFDAILAQPPGTVAGQIRLTE
QGEVIQSKYKDAEVGRWHLELLVAATLESSLAPRAEATSAEDAHMAQHGPAMSFMSETAQ
RTYRGLVYDTPRFAEYFFAATPISEIAGLNIGSRPASRKKGQRIEDLRAIPWGFSWAQCR
LMLTGWYGMGSAIEAYLETGAPDAPRSRRARLAQLREMAREWPAFRTLLSNMEMVLAKSD
LAIAARYAQLVPQRALRERVFGMISAEHGRTLAMLKLLTQRELLADNPALQDSLRERFAY
IDPLNYLQIDLIRRHRAAQKHPEADVDKRVQRAIHLTINGIAAGLRNSG
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccattcgcccgcagtccgactccgcagaacccctgcgccacgatatccggctg
ctaggccgttttttaggcgccgtcattgaggaatgcgaaggcaaacgtgtctttgacacc
atcgaaacgctgcgccgcacggcagtgaagtttcgccgcgaaggcaatgaggcggacagc
aagctgctggagcagcgcgtcaagcgcttgcaaggcaacgacccgaattcggtggcgcgc
gccttcagctatttcctgcacctggccaacattgccgaagaccgcgaccagaaccgcaat
cagcgcgcccgcgcgctggccggcgacaccgccccgcgcggcagcctgcgcgatgccgtg
cagacgctgggcaagcaaggcgtgggcgtggcccgcatccgccggctgctggcggatgcc
agcgtagtgccggtgctgaccgcgcaccccaccgaagtgcagcgcaagagcacgctggac
gtgcaccgcgaaattgccgccgcgctgacccagcgcggcaacccgctgacgccggaagag
ctggccgaactggatgccgcgctgcttggccgcgtggccaccttgtggcagacccgcatg
ctgcgctacacgcgcctgacggtggccgacgagatcgaaaacgcgctgtcgtactaccgc
agcacctttctgcaagtcatcccgcgcctgtacgcggatttgtccaagctcttgaaccgc
gagacggccaagccgtttgccgccccgccccctccgctggaaccgttcctgcgcatgggt
agctggatcggcggcgaccgcgacggcaatcccaatgtggatgccagcacgctggagcgc
gcgctgctgcgccaggccaccgtgctgttcgagcactatctgcaagaggtgcacgcgctg
ggcgcggaactgtcgatcaccaccatgctgatttcggccgacccggaattgctggcgctg
gccgacaacagcggcgacgattccccgcaccgccgcgacgagccctaccgccgcgcgctg
gtcggtgtgtacgcccgcctggccgccaccgcccaggcgctgaccgggcagaacctggcg
cgccgcagcaccgtggcggcgcccgcctaccaagcgccgcaagaactgtcgaccgacctg
gccatcatcgccgcgtcgctggccgcgcaccatggttcgccgctggccaagctgcggctg
tccggcttgcaacaggccattgaggtgttcggttttcacctggccaccgtcgacctgcgc
caaagctcagacgtgcatgaaaacgccttggccgaattgttcgaacgcgccggcgtccag
cacgacggcaagccgctggactacctgtcgcttgacgaagaccagcgcgtggcgctcttg
cgcgccgaactggcccaggcccgcccgctggcctcgccctggatcgcttacagcgaagac
accacgcgcgaactggccgtattgcgcgccgccgccgccggccgcgcgcgctatggcaag
caggcagtgcgccagaccatcgtgtcgcataccgaaaccttgagcgacctgctggaagtg
atggtgctgcaaaaggaagccggcctgatcgcgccggccggccaggacatcgcgcccgaa
gacggcctgatggtggtgcctctgttcgaaaccatccccgacttgcagcgcggcgccgac
atcatggccgcctggctggacctgcccgaggtgcgccagcgcgtgaagcaggcgcagaac
ggcgcgcaggaagtcatgctgggctattccgacagcaataaggacggcggtttcctcacg
tcgaactggtcgctgtaccaggccgaacgcgcgctggtggatgtgttttcggcgcgcaac
gtgcgcctgcgcctgttccacggacgcggcggctcggtgggacgcggcggcggttcaagc
tttgacgccatcctggcgcagcccccgggcacggtggccggccagatccgcctgaccgag
caaggcgaagtcatccaaagcaagtacaaggacgccgaggtgggccgctggcacctggaa
ctgctggtggcggccacgctggaatccagcctggcgccgcgcgccgaagccaccagcgcc
gaagacgcgcacatggcgcagcacggcccggcgatgtcgttcatgtcggaaaccgcacag
cgcacctaccgtggcctggtctacgacacgccgcgctttgccgaatacttcttcgccgcc
acccccatcagcgaaatcgccgggctgaacatcggttcgcgcccggcttcccgcaagaag
ggccaacgcattgaagacctgcgcgccattccctggggcttttcgtgggcgcaatgccgc
ttgatgctgaccggctggtacggcatgggttcggccatcgaggcctatctggaaacgggc
gcccccgacgccccccgctcgcgccgcgcccgcctggcgcaactgcgcgagatggcgcgc
gagtggccggcgtttcgcacgctgttgtccaacatggaaatggtgctggccaagtccgac
ctggccatcgccgcgcgctacgcgcaactggtgccgcagcgcgcgctgcgcgagcgcgtg
ttcggcatgatcagcgccgaacacggccgcacgctggccatgctgaagctgctgacccag
cgcgaactgctggccgacaacccggccctgcaagattccttgcgcgaacgctttgcgtat
atcgatcccttgaattatttgcagatcgacctgatccgacgccaccgcgcggcgcagaag
catcccgaggcggatgtcgacaagcgggtgcagcgcgcgattcacttaacgatcaacggc
atcgccgcggggctgcgcaattccggctag

DBGET integrated database retrieval system