KEGG   Achromobacter spanius: CVS48_13155Help
Entry
CVS48_13155       CDS       T05274                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
asw  Achromobacter spanius
Pathway
asw00061  Fatty acid biosynthesis
asw00780  Biotin metabolism
asw01100  Metabolic pathways
asw01130  Biosynthesis of antibiotics
asw01212  Fatty acid metabolism
Module
asw_M00083  Fatty acid biosynthesis, elongation
asw_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:asw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CVS48_13155
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CVS48_13155
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CVS48_13155
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:asw01004]
    CVS48_13155
Enzymes [BR:asw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CVS48_13155
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CVS48_13155
Lipid biosynthesis proteins [BR:asw01004]
 Fatty acid synthase
  Component type
   CVS48_13155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AUA56890
UniProt: A0A3S4RNW2
LinkDB All DBs
Position
complement(2902361..2903149)
Genome map
AA seq 262 aa AA seqDB search
MNAPTSNAALPLAGKRGLVTGIANADSIAWGCAKAFRAMGAELAVTYLNDKALPHVEPLA
RQVDAPLLMPLNLLNDGELEAAFDRITAEWGHLDFVLHSIAFAPRDDLHGRVTDCSREGF
LQAMDVSCWSFIRMAKLAEPLMTKGGALFCMSYYGSQMVVEHYNMMGPVKAALESATRYL
AAELGPQGIRVHAISPGPLKTRAASGIAEFDALLDRAQSKAPARSLVSIDDVGEATAWLA
TDAARLMTGQTLYIDGGYHIID
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccctacctcgaacgcggcgctgccgctggccggcaagcgcggcctggtgacc
ggcatcgccaacgccgattccattgcctggggctgcgccaaggcgtttcgcgccatgggc
gccgaactggccgtgacctatctgaatgacaaggcgctgccccacgtcgagccgcttgcg
cgccaagtggacgcgccgttgctgatgccgctgaacctgctgaacgacggcgaactggaa
gcggcgttcgaccgcatcacggccgaatggggtcacctggacttcgtgctgcactccatc
gccttcgccccgcgcgacgacctgcatggccgcgtgacggactgctcgcgcgaaggcttc
ctgcaagccatggacgtgtcgtgctggtcgttcatccgcatggcgaagctggccgaaccg
ctgatgaccaagggcggcgccctgttctgcatgagctattacggctcacagatggtggta
gagcactacaacatgatggggccggtaaaggcagcgctggaatcggccacgcgctatctg
gccgccgaactcggcccgcaaggcatccgcgtacatgccatttcacccgggccactgaaa
acgcgcgccgcctccggcattgcggaattcgacgcgctgctggaccgcgcgcaatccaag
gcgcccgcgcgcagcctggtgtccatcgacgatgtgggcgaagccaccgcgtggctggcc
accgacgccgcacggctcatgaccgggcagacgctgtacatcgacggcggctatcacatc
atcgattag

DBGET integrated database retrieval system