KEGG   Achromobacter spanius: CVS48_13195Help
Entry
CVS48_13195       CDS       T05274                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
asw  Achromobacter spanius
Pathway
asw00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:asw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CVS48_13195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:asw02000]
    CVS48_13195
Enzymes [BR:asw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CVS48_13195
Transporters [BR:asw02000]
 Other Transporters
  Pores ion channels [TC:1]
   CVS48_13195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AUA56898
UniProt: A0A2K8S4I5
LinkDB All DBs
Position
2910724..2911338
Genome map
AA seq 204 aa AA seqDB search
MLTLYHAPRSRSFRVLWLLEELGVPYDTEMVSIRGTDSAGHMPADYIDIHPHRKVPALVH
DGVPIFETPAIALYLTDLFPEKGLGPLVGDAQRGPYLTWLAYSTGVFEPAMVERAFKRPH
QDGAPGWGSADEVEQVLTRVLQARPYFLGDTFSAVDIVLGGSLQYMVQVKVIPESPVFNA
YFERLGARPAMHRALQRDGDIEES
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcttacgctttaccatgcgccgcgctcgcggtcgttcagggtgttgtggctgcttgag
gaattgggcgtgccctacgacaccgaaatggtgtccattcgcggcaccgacagcgcgggg
catatgcccgccgactacatcgacatccatccccaccgcaaggtgcccgccttggtgcac
gacggcgtgcccatcttcgaaacccccgccattgcgctatacctgacggaccttttcccc
gaaaaagggctggggcccttggtgggcgacgcgcagcgcgggccctatctgacgtggctg
gcctattccaccggcgtgttcgagcctgccatggtggaacgcgccttcaagcggccgcac
caggacggcgcgccgggttgggggtcggccgacgaggttgaacaggtgctgacccgggtg
ttgcaggcccggccgtacttcctgggcgatacgttttcggccgtggacatcgtgctgggc
gggtcgctgcaatacatggtgcaggtgaaggtgatacccgaatcgcccgtgttcaacgcc
tacttcgaacggctgggggcgcgcccggcgatgcaccgggccttgcagcgcgacggcgac
atcgaagaatcctga

DBGET integrated database retrieval system