KEGG   Achromobacter spanius: CVS48_13645Help
Entry
CVS48_13645       CDS       T05274                                 

Definition
(GenBank) alcohol dehydrogenase AdhP
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
asw  Achromobacter spanius
Pathway
asw00010  Glycolysis / Gluconeogenesis
asw00071  Fatty acid degradation
asw00350  Tyrosine metabolism
asw00625  Chloroalkane and chloroalkene degradation
asw00626  Naphthalene degradation
asw01100  Metabolic pathways
asw01110  Biosynthesis of secondary metabolites
asw01120  Microbial metabolism in diverse environments
asw01130  Biosynthesis of antibiotics
asw01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:asw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVS48_13645
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CVS48_13645
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CVS48_13645
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CVS48_13645
   00626 Naphthalene degradation
    CVS48_13645
Enzymes [BR:asw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CVS48_13645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AUA56979
UniProt: A0A2K8S304
LinkDB All DBs
Position
complement(3002212..3003237)
Genome map
AA seq 341 aa AA seqDB search
MDKTMKAAVARAFGEPLVIEEVAVPRPGPGELLVKIEACGVCHTDLHAVQGDWPVKPKPP
FIPGHEGVGHVVAVGAGVTHVKEGDRVGIPWLYSACGHCEHCLGGWETLCEQQQNAGYSV
NGGFAEYALAAADYVGLLPKNVGFVDIAPVLCAGVTVYKGLKMTDTRPGNWVVISGIGGL
GHMAVQYARAMGLNVAAVDIDDTKLELARRLGAEVTVNARTTDPAAYLKREIGGAHGALI
TAVSPKAFEQAMGMVRRGGTVALNGLPPGDFPLSIFDMVLNGVTVRGSIVGSRLDLQESL
QFAEAGKVRATVSTDRLENINSVFDRMKQGQIEGRVVLDFA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggacaagacaatgaaagccgccgttgcgcgcgcatttggcgaacccctggtgattgaa
gaagtggccgtgccgcgcccggggccgggcgaactgctggtcaagatagaagcctgcggc
gtctgccataccgacctgcacgccgtccagggcgactggcccgtcaaacccaagccgccc
ttcattccgggccacgaaggcgtgggccacgtggtggcggtgggcgccggcgtgacccat
gtgaaggaaggcgaccgcgtgggcattccctggctgtattccgcctgcggccactgcgaa
cactgcctgggcggctgggaaacgctgtgtgaacagcagcagaacgcaggctattccgtc
aacggcggtttcgccgaatacgcgctggctgccgccgactacgtggggctgttgcccaag
aacgtgggctttgtcgacatcgcccccgtgctgtgcgcgggcgtcaccgtgtacaagggc
ctgaagatgacggacacgcggcccggcaactgggtcgtcatctccggcatcggcgggctg
ggccacatggcggtgcaatacgcccgcgccatgggcctgaacgtggccgcggtggacatc
gacgacaccaagctggagctggcccgccgcctgggcgccgaggtcaccgtcaacgccagg
accaccgaccccgccgcttacctgaagcgcgaaatcggtggcgcgcatggcgcgctgatc
acggccgtatcgcccaaggcgtttgagcaggcgatgggcatggtgcggcgcggcggcacc
gtggcgctgaacggtttgccgccgggcgacttcccgctgtcgatcttcgacatggtgttg
aacggcgtcaccgtgcgcggctctatcgtgggctccaggctggacctgcaagagtccttg
caatttgccgaagccggcaaggtgcgcgccacggtgtccacggatcggctggaaaacatc
aacagcgtgttcgaccgcatgaagcagggccagatcgaaggccgggtcgtgctggacttt
gcctga

DBGET integrated database retrieval system