KEGG   Achromobacter spanius: CVS48_20040Help
Entry
CVS48_20040       CDS       T05274                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
asw  Achromobacter spanius
Pathway
asw00564  Glycerophospholipid metabolism
asw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CVS48_20040
Enzymes [BR:asw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CVS48_20040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 GIDA NAD_binding_8 Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AUA58100
UniProt: A0A2K8S673
LinkDB All DBs
Position
4448749..4450344
Genome map
AA seq 531 aa AA seqDB search
MNQPLANVTPPDRNRLLSTLDNTPSWDVIVIGGGATGLGTAVDAAARGYRTLLIEGADFA
KGTSSKATKLVHGGVRYLAQGNVSLVREALHERGLLNRNAPHLVWPLGFVVPAYNLFDQP
FYGIGLKMYDMLAGKLNLAPSRWLSRRDTLANAPTLAENVNGRGLKGGVLYYDGQFDDAR
LAMSLMRTLFDLGGTAVNYVRATGLSTSNGKVDGVTAQDVIGGASFSLRARCVINATGVW
VDAVRRMEDKNAATMVAPSQGVHLTLPQEFLPGKRAILIPKTDDGRVLFVVPWNGHTIVG
TTDTPRGDLPLDPEAGAQDVDFILSTAARYLSRKPTRDDVTSVWSGLRPLVKATGEASTK
QLSREHTILVSNAGLVTVTGGKWTTYRRMAQDVVDTAIQHQLLTQATCRTESLPLHGAAG
LAPSEEHAGTPDSYYGSDLAVLKALPGADRMLVKASGLSEAHVRFAARYELARSAEDVLA
RRNRALFLDAEAAMLAAPEVARILAEELGHDAAWQQRTLQELATVAKTYRL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaccgctagccaacgtcaccccgcccgatcgcaaccgcctgctgtccacgctg
gacaacacgccgtcctgggacgtcatcgtcatcggtggcggcgcaacgggcctgggcacc
gccgtggacgccgccgcgcgcggttaccgcaccctgctgatcgaaggcgccgacttcgcc
aagggcacgtccagcaaggccaccaagctggtgcatggcggcgtgcgctatctggcccaa
ggcaatgtcagcctggtgcgcgaagcgctgcacgaacgtggcttgctcaaccgcaacgcg
ccgcacctggtgtggccgctgggctttgtggtgcccgcctacaacctgttcgaccagccc
ttctacggcatcggcctgaaaatgtacgacatgctggccggcaagctgaacctggcgccc
agccgctggttgtcgcgccgcgacacgctggccaacgcccccacgctggcggaaaacgtc
aatgggcgcggcttgaagggcggcgtgctgtattacgacggccagttcgacgacgcgcgc
ctggcgatgagcctgatgcgcacgctgttcgacctgggcggcacggccgtgaactatgtg
cgcgccacgggtcttagcaccagcaacggcaaggtcgacggcgtgaccgcgcaagacgtg
atcggcggggccagcttctcgttgcgcgcgcgctgcgtgatcaacgccaccggcgtctgg
gtggacgccgtgcgccgcatggaagacaagaacgcggccacgatggtggcgcccagccag
ggcgtgcacctgaccttgccgcaagagttcctgcccggcaagcgcgccatcctcatcccg
aagaccgacgacggccgcgtgctgttcgtcgtgccatggaacggccacaccatcgtgggc
accaccgacacgccgcgcggggatctgccgctggacccggaagccggcgcgcaagatgtg
gacttcatcctgagcaccgccgcgcgctacctcagccgcaagccgacccgcgacgacgtc
accagcgtctggtcgggcctgcgtccgctggtcaaggccacgggcgaggcttcgaccaag
cagttgtcgcgcgagcacacgattttggtgtccaacgccgggttggtgacggtaacgggc
ggcaagtggacgacctaccgccgcatggcgcaggacgtggtggacacggcgattcaacat
cagctgttgacgcaggcaacgtgccggaccgaatcgctgccgctgcacggcgcggcgggg
ctggcgccgtccgaagagcatgcaggaacgccggacagctattacggcagcgatcttgcg
gtgttgaaagcgctgccgggcgctgaccgcatgctggtcaaggccagcggcctgtcggaa
gcgcacgtgcgttttgcggcgcgctatgaattggcacgcagcgccgaagacgtgctggcc
cgccgcaaccgcgcgctgttcctggacgcggaagccgcgatgctggccgcccccgaagtc
gcccgcatcctggccgaagagctgggccacgatgcagcctggcagcaacgcacgctgcaa
gagctggccacggtagcaaaaacgtatcgactgtag

DBGET integrated database retrieval system