KEGG   Alkalitalea saponilacus: CDL62_00670Help
Entry
CDL62_00670       CDS       T04906                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
asx  Alkalitalea saponilacus
Pathway
asx00052  Galactose metabolism
asx00511  Other glycan degradation
asx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CDL62_00670
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    CDL62_00670
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CDL62_00670
Enzymes [BR:asx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CDL62_00670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: ASB47766
LinkDB All DBs
Position
complement(190023..192761)
Genome map
AA seq 912 aa AA seqDB search
MYSITSFRRQRQLSVFGFFFAILFFYSCTERPDHQVRERLSINDGWRFFKYDDAKNADGL
IYDVRSDIDEDIDQREADDQPVEGEWVEGEESVLKAWILPSGNDFIKDSAKRHVRPEGYP
GFDFPFVQASFDDGNWEKVNLPHDWGAREPFTYEVSGSMGRLPSHGVAWYRRSLDVPSSD
AGRQIYLEVEGAMSYAMVWLNGHLVGGWPYGYNSWQLDLTPYIIPGGKNQLAIRLDNPPI
SSRWYPGGGIYRNMWLIKTEPVHVGQWGTFITTRDVSEESAVVDLEVTIDNKSNENADVE
IVTFIYELDLNGNRTGKRVIEFAPQSANVAAGTKTAVNSSVTIANPRLWGSLPTQIPNRY
LAVTEVQKDGKVVDVFETPFGIRSLEFDAVNGLFLNGEHIYIKGVNQHHDLGPLGAAFNK
RAAERQLEILREAGVNSIRMAHNPPAPELLELTDKMGFLVVNEVFDVWERRKVPFDFHLI
FPDWYEQDLRSMVRRDRNHPSVIMWSYGNEVGEQYTGVDGAALSQKLNDILKDEDPTRPT
TASMNFAKPDMPMPATMDIISLNYQGEGIRIHPGYEHLQGIRTHPLYSEFHETFPNKMII
SSENAAALSIRGEYLFPVTPNSSAPVSDGIGGDSESLIVCAYELYTANFGSSVDRVFAAK
AQHPFVAGGFVWSGWDYLGEPTPYYDARSTYFGIVDLAGFKKNRFYLYQSHWRPELPMAH
ILPHWNWPDRVGKVTPVHVFTSGDEAELFLNGVSLGRKKKGEYEYRLRWDDVVYEPGELK
VVAYKNGEEWAQSFVKTTGAAESLNAEADRDRIKADGKDLSFVTISVTDEDGFVIPDAKH
PLRFSIEGPGEIVATDSGDPRDFEAFPSNERNAFNGLSLVIVRGISGKPGIIRVMAESDG
LKNAVAEIQTVR
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgtattctattaccagtttcaggagacaaaggcagttatctgtttttggtttctttttt
gctattctttttttctattcatgcactgaaaggcctgatcatcaggtcagagagcgtctt
tccatcaatgacggatggagattttttaaatacgatgatgcaaaaaatgctgatggcttg
atttatgatgttcggtctgatattgatgaagatattgaccaacgagaggcagatgatcag
cctgttgagggagagtgggttgaaggagaggaatctgtcctaaaagcgtggatccttcct
tccgggaatgattttattaaagactctgccaagcgccatgtcagacctgaaggatatccc
ggatttgattttccctttgttcaggctagttttgatgatggtaattgggagaaagtaaat
cttcctcacgattggggtgcccgggagcctttcacatatgaagtgagcggaagcatgggg
cgattgccgagccatggagtggcctggtacaggcgttccttggatgttccttcttcggat
gcaggtagacaaatttatcttgaagtagaaggagccatgtcttatgccatggtttggtta
aacggacatttggtgggaggctggccttatgggtataactcatggcaactggatttaaca
ccttacatcataccgggagggaagaatcagctggccatacgtttggataatcctcccata
tcatcacgatggtatccgggtggtggaatttatagaaatatgtggctcattaagaccgag
cctgtacatgttggccaatggggcacttttataacaacaagagatgtttcagaagagtca
gcagtggttgatctggaagttactattgataacaaatcaaatgagaatgctgatgttgaa
attgtaacctttatatatgaattagacttaaacggaaatagaactggtaaaagagtcatt
gaatttgcacctcaaagtgcaaatgttgcagctggaacaaagacagctgtaaacagcagc
gttaccattgctaatccacggttatggggatcacttcctacccaaatacctaacaggtat
cttgccgttactgaagttcagaaagacggaaaagtagttgatgtttttgagactccattt
ggaataagatctttggagtttgatgcggttaacggtttatttttaaatggtgagcatatt
tatataaaaggcgttaaccaacatcatgatcttggtccattgggagcagcgtttaacaaa
agagcggcagagcgtcagcttgaaattctgcgtgaagcaggagtaaactccatacgcatg
gctcacaatcctcccgcaccagaattgttggagttgaccgacaaaatgggttttttggtg
gtgaatgaagtgtttgatgtttgggaaagaagaaaagtgcctttcgatttccatttgatt
tttcctgattggtatgagcaggatttgcgatcaatggtacgaagggatcgcaatcaccca
tctgtaattatgtggagctatggaaacgaagtaggagaacaatatacaggcgttgatggt
gctgcattgtctcagaaactcaatgatatcctaaaagatgaagatccaacccggccaaca
actgcttccatgaattttgccaagcctgatatgccaatgcctgcaaccatggatatcatc
agcttaaattaccagggagagggcattcgcattcatccgggatatgaacatttgcaaggc
attcgtacacaccctttatactcggagtttcacgaaacatttcccaacaaaatgatcatt
agcagtgagaatgctgcagcattaagcataagaggagagtacctgtttcccgttaccccg
aattcgagcgctccggtgagtgatggaattggaggtgattctgaaagcctaattgtttgt
gcttatgaattatacactgcaaattttggatcttctgttgaccgggtatttgcagccaag
gctcaacacccctttgtggcaggaggtttcgtatggagtggatgggattatttaggtgaa
ccaacgccatattatgatgcaaggagcacctattttggaattgtagatttggccggattt
aaaaagaaccgtttttatctttatcagtcacattggcgtcctgaattgccaatggctcac
attcttcctcactggaattggccggacagggttgggaaagttaccccagtgcatgtgttt
acatcgggtgatgaggctgaattgttcttaaacggagtctctttgggaagaaaaaagaag
ggagagtatgagtatcgtctacgttgggatgatgttgtttacgaacctggagaattgaag
gttgtagcatataaaaatggtgaagagtgggcacaaagttttgttaagacaactggggct
gccgaatctctgaacgctgaagctgatcgtgacagaattaaagctgatggaaaagatctt
tcatttgtgactatttcagtaactgatgaggatggatttgtcataccggatgctaagcac
ccgctccggtttagcattgaagggccgggtgaaattgtcgctaccgatagtggagatccc
cgggatttcgaggctttcccgtcaaatgaacgaaatgcttttaatggattgagtctggtt
attgtcagggggatttctggtaaaccgggaatcattagggttatggctgaatctgatgga
ttaaaaaatgctgtggctgaaatacaaactgtacgttaa

DBGET integrated database retrieval system