KEGG   Alkalitalea saponilacus: CDL62_01870Help
Entry
CDL62_01870       CDS       T04906                                 

Definition
(GenBank) glycoside hydrolase family 2
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
asx  Alkalitalea saponilacus
Pathway
asx00052  Galactose metabolism
asx00511  Other glycan degradation
asx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CDL62_01870
  Lipid metabolism
   00600 Sphingolipid metabolism
    CDL62_01870
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CDL62_01870
Enzymes [BR:asx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CDL62_01870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N DUF4982 Glyco_hydro_2
Motif
Other DBs
NCBI-ProteinID: ASB47987
UniProt: A0A1T5EX11
LinkDB All DBs
Position
complement(495358..497712)
Genome map
AA seq 784 aa AA seqDB search
MTTIIYKKWKNLFTLLLISIFIFSGCMVDDHDYPSSRITISFNNDWMFMEGDHDGAQARR
FNDRSWRALNVPHDWSIEGEFDQNNPTGRGGGYLPNGIGWYRKSFDIPSAFEGRRVFIHF
DGLMANSDVYINGEHLGHRPYGYVSMEYELTDYLRYGRSNTIAVRLDNSKQPASRWYTGA
GIYRNVRLIVKNDVHIDNWGTFFSTPKVSEESATVRVFTTLKNSSEISHQVHLNTLIHNP
TGDLVSEKGTVIDLAPGEKIDIEQILEVLNPQLWSLDSPQLYKGISQVTIDNELQDDLVT
NFGIRSFHFEPATGFYLNGENIRIKGVCLHHDAGAVGAAVPLAIWEERFNQLQSIGINAI
RLSHNPFAPEFLELCDRMGFIVMNESFDTWRARKNHGDYGYQHHFDEWWEEDTRSIVLRD
RNHPSIFMFSIGNEIRDNLDNEQGFETFRMQYDLVHKLDGTRPVTMGLFRPNQANVYQNG
FAEMMDIVGQNYREEELLQASIDNPHWKVIGTENGHTRQAYLIWRDNPAIAGHFLWTGFD
YLGEADWPEVSHDFGLFDRAGFTKPRTYERESWWSDKPMIRIFRREQHLGEGGLVDDWTP
TDFDTYDEAHIEIYTNCDEVELIFNGESQGVRKRPADHSPIRYRLTYQPGSIKAIGRIDG
KDVAIHEMQTAMPPSNIALSASKTTLKNDWDDVAIVRVMLTDENGVHSPNFDRPLTFNVS
GNGELIAVDNGQRDSHEPFKTNVRRTSRGQAIAIVRANADVGQILVSVSGEGLEESSIEI
NINQ
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgaccactattatctacaaaaaatggaaaaatctttttacccttctattgatttcaata
tttatttttagcggatgtatggttgacgaccatgactacccttcatctcgcataacaatt
tcatttaacaatgattggatgtttatggaaggagatcatgatggagctcaggcaagaagg
tttaatgaccgaagttggagagcgctgaatgttccccatgattggagtatagaaggagag
tttgatcagaataatccaaccggaagaggaggggggtatttgccaaatggtattggctgg
tatagaaaatcgttcgatattccatctgcctttgaaggaagaagagtttttatccacttt
gatggccttatggccaatagtgatgtttatattaacggagagcatcttgggcacagaccc
tatggctacgtgagcatggaatatgagttgaccgattacttaaggtacggccgctctaat
accatcgctgtgcgtttggataattcaaaacagccagcatcacgatggtacacaggtgct
ggaatttatcgaaatgtccgtcttatagtgaagaatgatgtgcatattgataattgggga
acttttttttctactccgaaagtctctgaagagtctgcaacagtaagagtgtttaccact
ttgaaaaatagttctgagattagccatcaagtgcatttaaatacgctgatccataatcct
acaggggatcttgtttcagaaaaagggactgttatagatttggcaccaggagaaaaaatc
gacattgaacaaatattagaggtgcttaaccctcaattgtggtctcttgattctcctcaa
ctttataaaggtatttcacaagtgactatagataatgagttgcaggatgaccttgtaact
aactttggaataaggtcatttcattttgagcctgctaccggattttacctcaatggtgag
aacatcagaattaaaggtgtatgtcttcatcatgatgcaggtgcagtcggtgcagccgtg
cctcttgcaatttgggaggaaagatttaatcaacttcaatcaatcggaattaatgccata
agattatcacacaatccttttgcacccgaatttctggagttgtgcgaccgcatgggattc
attgttatgaatgaaagttttgatacctggcgtgcacgtaaaaaccacggagattacgga
tatcaacatcattttgatgaatggtgggaggaagacacacgttccattgttctaagagat
cgcaatcacccgtccatatttatgtttagcattggtaacgaaattagggataatcttgat
aatgagcaggggtttgaaacattcaggatgcagtatgatcttgttcataaactagatggg
acacgccctgttacaatggggttgttcagacccaatcaagccaatgtttatcagaatgga
tttgctgaaatgatggatattgtagggcaaaattatcgggaagaagagttgctgcaagca
tcaattgataacccacactggaaagtaattggtacggaaaacgggcataccagacaggca
tatctgatttggagagataatcctgccatcgccggacactttctatggacaggattcgat
tatcttggcgaagccgactggcctgaggtgtcgcatgattttggcctttttgatcgcgct
ggttttaccaaaccacgcacctacgaaagagaaagttggtggtctgataagcctatgatc
agaatcttcagacgtgaacaacatttaggtgaaggaggacttgtggatgattggacacct
actgattttgatacatatgatgaagctcatatcgaaatttataccaattgtgatgaagtg
gaattgatctttaatggtgaatcgcagggtgtcagaaaacgtcctgccgatcattcaccc
ataagatatcgactgacctatcagcctgggtctataaaagcaattgggcgaattgatgga
aaagatgttgcaattcatgagatgcaaacggctatgcctccttctaatattgcactatca
gcgtctaaaactacattgaaaaatgattgggatgatgtggccatcgttcgtgttatgctg
actgatgaaaatggcgttcattctcccaattttgatcggccattgacttttaatgtttca
ggaaatggagagctaattgcggtagataacggacaacgggatagccacgagccatttaag
accaatgtgagaagaacatccagaggacaagccattgctattgtgagagctaacgctgat
gttggacagattcttgtgtctgtgtccggtgaaggtctggaagagagctccattgagatt
aatataaaccaataa

DBGET integrated database retrieval system