KEGG   Alkalitalea saponilacus: CDL62_02515Help
Entry
CDL62_02515       CDS       T04906                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
asx  Alkalitalea saponilacus
Pathway
asx00240  Pyrimidine metabolism
asx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CDL62_02515
Enzymes [BR:asx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CDL62_02515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ASB48092
UniProt: A0A1T5HFH1
LinkDB All DBs
Position
complement(698895..699479)
Genome map
AA seq 194 aa AA seqDB search
MFLENRQNNRNKRHGWIEVICGSMFSGKTEELLRRLRRARIARQNVEIFKPLVDRRYSEE
EVVSHDANSIRCTPVESSGNILLLSGNTDVIGIDEAQFFDNGLVDVCNTLAGQGIRVIIA
GLDMDFKGKPFGPMPGLMACAEYVTKVHAICMQCGDLAHFSYRFKASDRLVEVGAAESYE
AVCRNCYHQLNRSK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaaccgtcaaaataacaggaataagcggcatggatggatcgaagtcatt
tgtggttccatgttctccggaaaaactgaggagttgttgcgccgattgcgccgtgcacgt
attgcacggcaaaatgtggagatttttaagcctttggttgacaggcgatacagcgaggaa
gaagttgtttcgcacgatgctaacagcatccgatgcacacctgttgaaagctccggaaac
atactgttgttaagtggtaataccgatgtcattgggattgatgaagcacagttttttgat
aatggattggttgatgtttgcaacacattggccggccagggaatacgtgtaattattgcg
ggactggatatggatttcaaaggaaaaccttttggacccatgccgggtttaatggcttgc
gccgaatatgtaactaaagttcatgccatctgcatgcaatgtggtgatttggcacatttc
tcctacaggtttaaagccagtgatagactggtggaagtaggcgccgccgaatcatacgaa
gctgtttgccgcaattgctaccatcagttaaaccgaagcaaatga

DBGET integrated database retrieval system