KEGG   Alkalitalea saponilacus: CDL62_10765Help
Entry
CDL62_10765       CDS       T04906                                 

Gene name
cobC
Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
asx  Alkalitalea saponilacus
Pathway
asx00860  Porphyrin and chlorophyll metabolism
asx01100  Metabolic pathways
Module
asx_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:asx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDL62_10765 (cobC)
Enzymes [BR:asx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     CDL62_10765 (cobC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ASB49588
UniProt: A0A1T5BUR4
LinkDB All DBs
Position
2747679..2748230
Genome map
AA seq 183 aa AA seqDB search
MQLTLIRHIKTFAPEGLCYGQTDIGLPPGYGKVHAGIAEKLKDSKFDVIFSSPLQRCKLL
AEAISKNRQPIVCDDRLKELNFGEWEMKMWSDIESSAEAKLFFEDYINVAPPGGESFQEM
IHRIKTFNQELRKNYTGKRVLIVSHGGPIRVFVGLNKNIEIQDIFDIRVDYGQLIKLMQR
TGE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcactctcatccgacatataaaaacctttgcgccggaaggtttgtgctatggg
caaacagacatagggcttcctcccggctatggaaaagtgcatgccggaattgctgaaaag
cttaaggattccaaatttgatgtgatattttccagccctttgcagcgttgcaaacttttg
gcagaagctatttcaaaaaacagacaaccaattgtgtgtgatgatagattgaaagaactt
aattttggagagtgggaaatgaagatgtggtcagatattgaatcatctgctgaggcaaag
ttgttttttgaggattatataaatgttgcgcctccgggaggcgaatcatttcaggaaatg
attcaccgcatcaaaacttttaatcaagaacttagaaaaaactatacaggcaaaagggtt
ttaattgtttcgcacggtggcccaatacgcgtgtttgtggggttaaacaaaaacatagaa
atacaagatatttttgatattcgggttgattacggccaactgattaagttgatgcaaagg
acgggagagtaa

DBGET integrated database retrieval system