KEGG   Alkalitalea saponilacus: CDL62_16630Help
Entry
CDL62_16630       CDS       T04906                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
asx  Alkalitalea saponilacus
Pathway
asx00020  Citrate cycle (TCA cycle)
asx00480  Glutathione metabolism
asx01100  Metabolic pathways
asx01110  Biosynthesis of secondary metabolites
asx01120  Microbial metabolism in diverse environments
asx01130  Biosynthesis of antibiotics
asx01200  Carbon metabolism
asx01210  2-Oxocarboxylic acid metabolism
asx01230  Biosynthesis of amino acids
Module
asx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
asx_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:asx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDL62_16630
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CDL62_16630
Enzymes [BR:asx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CDL62_16630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ASB50658
UniProt: A0A1T5DCP8
LinkDB All DBs
Position
complement(4352432..4353661)
Genome map
AA seq 409 aa AA seqDB search
MSKIKVINPVVELDGDEMTRIIWKMIKEELILPYLDLDIKYFDLGMESRDATDDQITIDA
ADAIRKYNVGIKCATITPDENRVEEFGLKKMWKSPNGTIRNILGGTVFREPIIIKNLPRL
VPGWEYPICIGRHAFGDQYRATDFLVKGKGKLTITFTPEDGGEVQSYDVYDFEGDGVALA
MYNTDESIRGFAHSCFNQAINKKWPLYLSTKNTILKKYDGRFKDIFQEIYDNDYKQKFEE
LGITYEHRLIDDMVAAALKWNGNFVWACKNYDGDVQSDTLAQGFGSLGLMTSTLVTPDGK
TMEAEAAHGTVTRHYRMHQQGKPTSTNPIASIFAWTRGLAFRGKLDNNQALIEFANTLEA
VCVETVESGQMTKDLALTIHGKDLKDEHYLTTEGFMAAIKSHLDIKMAK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaataaaagtaatcaatccggtggttgaactggatggagatgaaatgacacgc
atcatttggaaaatgattaaagaagagctgattcttccttatctcgatcttgatattaaa
tattttgacttgggaatggaaagccgcgacgcaactgatgatcaaataacaatagatgcc
gccgatgccattcgtaaatacaatgtgggaattaaatgtgccaccattacaccagacgaa
aaccgtgtagaggagtttggattgaagaaaatgtggaagtcacccaatggtaccattcgt
aacatcttgggagggactgttttccgcgaacccatcatcattaaaaatttaccacgactg
gttcccgggtgggagtatcccatctgcattggccgtcatgcctttggagaccagtaccgt
gcaacagattttctggtgaaggggaaaggtaaacttaccatcactttcactcccgaagat
ggcggagaggttcagtcctatgatgtttatgactttgaaggcgatggcgtagctttagcc
atgtataataccgacgaaagtatcagaggttttgctcacagttgtttcaaccaggccatc
aataaaaagtggcctttgtatctctccaccaaaaataccatcctgaagaaatatgatggt
agattcaaagatatttttcaggagatttacgacaatgattacaagcagaagtttgaggaa
cttggtataacatacgaacatcgcttgattgacgatatggtggctgcagctcttaaatgg
aacggtaattttgtatgggcttgtaaaaactatgatggtgatgttcagtcggatacgctt
gcacagggatttggttcgttggggctgatgacctctacattggtaacacccgatgggaaa
accatggaagctgaagcagctcatggtactgtaacacgtcactaccgcatgcatcaacag
ggaaaacccacatcaaccaacccaattgcatctatttttgcatggacaagaggtttagct
ttcagaggcaaactggataacaatcaagctcttattgaatttgcaaacactttggaagct
gtgtgcgttgagactgttgaaagtggacaaatgaccaaagaccttgcgctgactattcac
ggaaaagatctgaaagatgagcattatctgaccaccgaaggatttatggcagccattaaa
tcccatttagacattaaaatggcgaaatag

DBGET integrated database retrieval system