KEGG   Candidatus Arsenophonus lipoptenae: AUT07_00270Help
Entry
AUT07_00270       CDS       T04248                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III subunit psi
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
asy  Candidatus Arsenophonus lipoptenae
Pathway
asy03030  DNA replication
asy03430  Mismatch repair
asy03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:asy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AUT07_00270 (holD)
   03430 Mismatch repair
    AUT07_00270 (holD)
   03440 Homologous recombination
    AUT07_00270 (holD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:asy03032]
    AUT07_00270 (holD)
   03400 DNA repair and recombination proteins [BR:asy03400]
    AUT07_00270 (holD)
Enzymes [BR:asy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AUT07_00270 (holD)
DNA replication proteins [BR:asy03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AUT07_00270 (holD)
DNA repair and recombination proteins [BR:asy03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AUT07_00270 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi
Motif
Other DBs
NCBI-ProteinID: AMA64852
UniProt: A0A0X9W6G2
LinkDB All DBs
Position
complement(320526..320921)
Genome map
AA seq 131 aa AA seqDB search
MIFSDQILSHMGITQWILRDSSVLQGEYLFSIPKSIQLVIISEEVIDLNNLLVRDILQAM
IIDSLQVCCISSKKAFLLPKEIICPCWILGYPLSINSKKWIINTVSLRELFFNPELKRTL
WMQICQHVYKI
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
gtgatattttcagatcaaatattaagtcatatgggaattacacaatggatattacgtgat
tcttcagtacttcaaggagaatatttattctctattcctaaatctattcaattagttatt
atttcagaggaagtaattgatttaaataatcttttagttagagatattctacaggcaatg
ataattgatagtttgcaagtatgttgtatttcaagtaaaaaagcatttttattaccaaaa
gaaattatttgtccttgttggattttaggttatcctttatctattaattcaaaaaaatgg
attattaacactgtatcattgagagaacttttttttaatcctgagttaaaacgtacttta
tggatgcaaatatgtcagcatgtatataaaatataa

DBGET integrated database retrieval system