KEGG   Acetobacter senegalensis: ASN_1213Help
Entry
ASN_1213          CDS       T04217                                 

Gene name
dadB
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
asz  Acetobacter senegalensis
Pathway
asz00473  D-Alanine metabolism
asz01100  Metabolic pathways
asz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:asz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ASN_1213 (dadB)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    ASN_1213 (dadB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:asz01011]
    ASN_1213 (dadB)
Enzymes [BR:asz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ASN_1213 (dadB)
Peptidoglycan biosynthesis and degradation proteins [BR:asz01011]
 Precursor biosynthesis
  Racemase
   ASN_1213 (dadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CEF40582
UniProt: A0A0U5EUH9
LinkDB All DBs
Position
I:complement(1154797..1155930)
Genome map
AA seq 377 aa AA seqDB search
MSSCSLPRADWAATRAGAVLTVDLGAIVDNYRQLVQRTAGAVCAAVVKADAYGLGAAHVA
PALQKAGAKEFFVAHVDEGLALRPSLSSHARITVLHGARPDALAECVESGLRPVLNSMEQ
IAQLRALAERKGKALDAVLQLDTGMSRFGLSASDVHQLFENPALLRGISLSLIMSHLACA
DTPENPANAQQLERLKQYAALLPPAPLSLAASSGIFLGAAYHQDLVRPGAALYGVAPNAS
GPNPLKQVVRLQARVLQTRTLSKGDRVGYGLTWQAEGPCRVATLATGYADGFARQGASTG
CAWFKGEKLPILGRISMDSMTVDVSAIPEAELAADALVDLLNAQYGVDDVAAAEGTIGYE
VLTSLGRRYHRVYQNHA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcctgttctcttccgcgtgctgactgggctgctacccgggcaggtgccgtgttg
acggtggatctgggagccatagtggacaattatcgccagcttgttcagcgcactgccggt
gcggtgtgtgctgcggtggtcaaagcggatgcctatgggcttggtgcggcgcatgtggcg
cctgctttgcaaaaggctggcgcaaaagagttttttgttgcgcatgtggatgaagggctg
gctctgagaccctccctttcgtcacacgcgcggattacagttctgcacggggcccggccg
gacgctttggcggaatgtgtggaaagcgggctgcggcctgtgctcaacagcatggaacag
attgcgcagttacgcgcactggctgagcggaagggcaaggcgcttgatgctgtcttgcag
ttggacacaggcatgtcccgtttcgggctttctgcaagcgatgttcatcagctttttgaa
aaccctgctctgctgagagggatatctctcagcctgatcatgagccatcttgcctgtgcg
gatacgccggagaacccggctaatgcccagcagttggagcggttgaaacagtatgccgcc
ctgttgcctccggcaccgctcagcctcgcggcgtcatccggtatttttctgggtgctgcg
tatcatcaggatctggtgcgccccggtgcagcactttatggcgtggcccccaatgcctct
ggccccaaccctctgaagcaggtggtgcgtttgcaggcgcgtgtgctgcaaacccgcacg
ctctcaaaaggagacagggtgggatacgggctgacatggcaggccgaggggccatgccgg
gtggcgacccttgccacaggctatgcggatggttttgcccgtcagggcgccagcacgggc
tgtgcgtggttcaagggggagaaattgcccattctgggccggatttccatggattccatg
acggtggatgtctctgccattcccgaggcggagctggcggctgatgcactggtggatctg
ctgaacgcacaatatggcgtggatgatgttgccgctgcggaagggaccatcggctatgag
gttctaacgtctctggggcggcggtatcaccgcgtttaccagaatcacgcgtga

DBGET integrated database retrieval system