KEGG   Acetobacter senegalensis: ASN_142Help
Entry
ASN_142           CDS       T04217                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
asz  Acetobacter senegalensis
Pathway
asz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:asz00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ASN_142 (gst)
Enzymes [BR:asz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ASN_142 (gst)
Transporters [BR:asz02000]
 Other Transporters
  Pores ion channels [TC:1]
   ASN_142 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin2_C GST_N_4
Motif
Other DBs
NCBI-ProteinID: CEF39587
UniProt: A0A0U5B4X3
LinkDB All DBs
Position
I:complement(70464..71132)
Genome map
AA seq 222 aa AA seqDB search
MRTLFHLPISPYCRKVRLVLGEKRLPFEAIIERVWEVRPEFLAMNPAGQVPVLVEDNGLI
VPDSHVICEYLEEAYSDTPLLGRTLAERVEVRRLVAWFDGYFAEKVTNRFIGERVMKRLS
GRGNPDGTVLREGYAAMKPNLKYVNHLAENRNWLAGNFLSLADFAAAAHLSSLDFIGDID
WSRIPAVRDWYARMKSRPCFRPLLTDRVAGITPPDYYANLDF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccctttttcatctccccatttctccctattgccgcaaggtccgtcttgtgttg
ggcgaaaaacgcctgccgtttgaagcgattattgaacgggtgtgggaggtgcgtccggaa
tttctggccatgaacccggcaggtcaggtgcctgttctggtggaagacaatggtctgatt
gttccagactctcacgtgatctgcgagtatctggaagaagcgtattccgataccccgctg
cttggccgcacgctggctgagcgggttgaagtacgccgccttgtggcgtggtttgatggc
tattttgctgaaaaagtgaccaaccgctttattggcgagcgtgtgatgaagcgcctgagc
ggtcggggcaaccccgatggtacggtgctgcgtgaaggttacgcggccatgaagccgaac
ctgaaatacgtgaaccatctggcggaaaaccggaactggctagccgggaatttcctgtct
ctggcggattttgccgcagcggcccatctatccagccttgattttattggggacatagat
tggtcccgtatcccggcggtgcgagactggtatgcccgcatgaagtcccgcccgtgtttc
cggccgctgttgacggaccgtgtggcgggcatcacgccgcccgactattacgccaatctt
gatttctga

DBGET integrated database retrieval system