KEGG   Acetobacter senegalensis: ASN_3590Help
Entry
ASN_3590          CDS       T04217                                 

Gene name
cydC
Definition
(GenBank) putative transport ATP-binding protein CydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
asz  Acetobacter senegalensis
Pathway
asz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:asz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ASN_3590 (cydC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:asz02000]
    ASN_3590 (cydC)
Transporters [BR:asz02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    ASN_3590 (cydC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_16 SMC_N AAA_22 RsgA_GTPase IstB_IS21 AAA_29 DUF87 AAA_25 MMR_HSR1 AAA_24 AAA RNA_helicase AAA_18
Motif
Other DBs
NCBI-ProteinID: CEF42815
UniProt: A0A0U5EZ22
LinkDB All DBs
Position
I:3653032..3654759
Genome map
AA seq 575 aa AA seqDB search
MPDVTQNSSAPATSSAGQPNTPAVTDRQAIFRILKLWQRQAPRLAIGLMLALLALCTGLL
LMQVSGLRLAGAVLGEVIITTALLRWVGVGRVFLRYSERLFAHDAMFRALADLRVWFFHS
LARGAAAGLGFRRAGDMLSRLVSDIGTLDGLYLRILLPFMCACLTLPILLVQLCSQNIIL
GCLTGLLFACSAFLFPYLIARSGRQDAERLTQNLSALRISVLDLVSGLREIRAFGAENRM
LARVQADDRALLDGQKHLARRAAIANATAYLCGQIAILFVLLAISGIVFSKVAPLSGVGI
LFLTVAAFESAGALTRAGVQAGAMGAAARRVVEIAQVAPVSAQTEQEADAPAGTDIQVTN
VKFRWSSDRPYVFDGLTLDIPAGSRVAILGPSGVGKSSLAALLLKAAAPESGCITLGGVN
ISHIRATSLRRQVAWLSQATHLFDDTIRSNLLLGKPEATEEDLWRALEEAAVAGVVRNLP
EGLDTWLGEGGVNLSGGQGRRIALARTLLTNAPIMILDEPATGLDAQTEQDFLRTLNTVT
AGRTVILIAHRLTGVEKLDQIWRLSHGQATTVAVS
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgtgacccagaactcctccgctcctgcaacctcttccgccgggcagccaaac
acgcctgccgtgacagacagacaggctatttttcgcattctgaagctgtggcagagacag
gctccccgtcttgcaattggcctgatgctcgcactcctggctttatgcaccgggcttctg
ctcatgcaggtttcaggcctccggttggctggtgccgtgcttggtgaggtgatcattaca
acggctctcctgcgctgggtcggtgtaggccgtgtatttctccgttattctgagcgccta
tttgcgcacgatgccatgtttcgggcgctggcagatttgcgagtatggtttttccattcc
ctcgcgcggggtgccgcagcaggactgggctttcgtcgggcaggggacatgctctcccgt
ctggtctcagacattggcacgctggacggcctgtatctgcgtattctcttgccgttcatg
tgcgcatgtctgacccttcctattctgctggttcagctttgcagccaaaacatcattctt
ggatgcctgactggccttctctttgcctgctctgcatttctgtttccttacctgattgcc
cgctctggtcggcaggacgcagaacgcctgacacaaaacctctccgcgttacgcatcagc
gttcttgatctggtcagcggcctgcgtgagatccgcgctttcggagcagaaaaccggatg
ctggcccgcgtacaagccgatgacagggcattactggatggccagaagcatcttgcgcgc
cgcgcagctatcgctaacgccacggcttatctgtgcggacaaattgctattcttttcgtt
ctactggccatttcaggcatagtgttctcaaaagttgcccccctttctggcgtgggtatc
ctgttcctgacagtggctgcctttgaaagcgcgggggctcttacccgggctggagtgcaa
gcgggcgcaatgggcgctgccgcccgacgtgttgtagaaattgcacaggttgctccggta
tccgctcaaacagagcaggaagcggatgctccagcaggcactgacattcaggtcaccaat
gtgaaattcagatggtcctcagatcgcccctatgtgtttgatggactaactcttgatatt
cctgctggctcccgcgttgccattctgggcccctccggcgtgggaaaatcgagccttgct
gcgcttctgctgaaagctgccgcccctgaatccgggtgtatcacgcttggcggggtgaat
atctcccacatccgagccacctctttgcgccgtcaggttgcgtggctttctcaggcaacc
catctgtttgacgatacaatccgctccaacctgcttcttggcaaaccagaagcaaccgaa
gaggatttatggcgcgcccttgaggaagcagccgtagcaggcgtcgtacgcaacttgccg
gaagggctggatacctggcttggtgaaggcggtgtcaatctttctggcgggcagggacga
cgaatagctcttgcacgcaccttgctgacaaatgcacccatcatgattttggacgagcca
gccacaggactggatgctcaaacggaacaggattttctgcgtacactcaatactgttaca
gcaggacgtacagttattctgattgcacatcgccttacaggggtagaaaaactggaccag
atctggcgtctttcacatggtcaggcaacaaccgttgctgtctcataa

DBGET integrated database retrieval system