KEGG   Acetobacter senegalensis: ASN_3633Help
Entry
ASN_3633          CDS       T04217                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
asz  Acetobacter senegalensis
Pathway
asz00010  Glycolysis / Gluconeogenesis
asz00020  Citrate cycle (TCA cycle)
asz00620  Pyruvate metabolism
asz01100  Metabolic pathways
asz01110  Biosynthesis of secondary metabolites
asz01120  Microbial metabolism in diverse environments
asz01130  Biosynthesis of antibiotics
asz01200  Carbon metabolism
Module
asz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:asz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASN_3633 (pdhC)
   00020 Citrate cycle (TCA cycle)
    ASN_3633 (pdhC)
   00620 Pyruvate metabolism
    ASN_3633 (pdhC)
Enzymes [BR:asz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ASN_3633 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: CEF42857
UniProt: A0A0U5EYP3
LinkDB All DBs
Position
I:3700609..3701877
Genome map
AA seq 422 aa AA seqDB search
MAIEVLMPALSPTMTEGTLARWLKKEGDTVSSGDVLAEIETDKATMEVEAVDEGILGKIL
ISEGTQGVPVNAPIAILVEEGEAVPETAAAPQKDASTPSKTDAVAPAETAPKAATPSVQK
SPVTSPAASAAHKVFASPLAKRIAKEKGLDLTQIKGTGPNGRIVRRDVENASAKPLSASA
AATAPAIAAAGGSTSVPHSTMRKVIARRLSEAKSTIPHFYVSVDIELDALMALRAQLNAT
SPEEGPDSFKLSVNDMLVKAAAVALKRIPTVNASFTEDAMILHDDVDISIAVSIPDGLIT
PIVRQADKKSLKQISQETKDLVKRARAGKLKPEEFQGGTFSISNMGMYGVKDFSAIINPP
QAAILAIAAGRKQPVVKGSELAIATVMTVTLSVDHRVVDGSVAAEWLSAFRSVVESPLTL
VI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaagttctgatgccggctctctctccgacaatgacagagggcacattggcc
cgctggctcaagaaggaaggggatactgtttccagcggggatgttcttgcggaaatcgaa
accgacaaggcgacgatggaagtggaggccgtggacgaagggattctgggaaaaatcctg
atttcagaaggcacacaaggcgtgccggtcaacgctcctatcgctattctggtggaagaa
ggggaggcagtgcccgagactgctgccgctcctcagaaagatgcttctacgccttcaaaa
acggatgcagttgctccagcggaaacggctcccaaagcagccacaccgtccgttcagaag
tcgcccgtgacctccccagccgcatctgccgcccacaaggtttttgcatctcctctggcg
aaacggatcgccaaagagaaggggctcgatctcacccagataaaaggcactggccccaat
ggccgcatcgtgcgtcgggatgtggaaaacgcgtcagcaaagccgctctccgcgtccgcc
gctgcaacggcgccagctatcgctgcggctggcggcagcacaagcgtgccgcactccacg
atgcgcaaggtcattgcccggcgcctcagtgaagccaaaagtaccattccgcacttctat
gtgtcggttgatattgaattggatgcgcttatggccctgcgcgcccagctaaacgcgacc
tcgccagaagaagggcctgattcattcaagctttctgtgaatgacatgttggtcaaggcc
gcagccgttgctctcaaacgcatcccgacagtgaatgcatccttcactgaagacgcgatg
atcctgcatgatgacgtggacatttccatcgccgtctccattcctgacgggttgatcaca
cccattgtccggcaggcagacaagaagagcctgaaacagatcagtcaggaaaccaaggat
ctggtgaagcgggcaagggcagggaagctgaagccggaagagttccagggtggaacgttc
tccatctccaatatggggatgtatggcgtgaaagacttctcggccatcattaacccgcca
caggctgccattctggccattgccgcaggccgcaaacagcccgtggtaaagggaagtgaa
ctggctattgcgacggtcatgaccgtcacgctttctgttgatcatcgggtagtagatggt
tccgtggcggctgaatggctttccgctttccggtcagtggtggaatctcccctgacactg
gtcatttga

DBGET integrated database retrieval system