KEGG   Acetobacter senegalensis: ASN_383Help
Entry
ASN_383           CDS       T04217                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
asz  Acetobacter senegalensis
Pathway
asz00020  Citrate cycle (TCA cycle)
asz00310  Lysine degradation
asz00380  Tryptophan metabolism
asz01100  Metabolic pathways
asz01110  Biosynthesis of secondary metabolites
asz01120  Microbial metabolism in diverse environments
asz01130  Biosynthesis of antibiotics
asz01200  Carbon metabolism
Module
asz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
asz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:asz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ASN_383 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    ASN_383 (sucA)
   00380 Tryptophan metabolism
    ASN_383 (sucA)
Enzymes [BR:asz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     ASN_383 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II Thymidylat_synt
Motif
Other DBs
NCBI-ProteinID: CEF39809
UniProt: A0A0U5EUT5
LinkDB All DBs
Position
I:complement(331837..334713)
Genome map
AA seq 958 aa AA seqDB search
MAASDVLVTALNGANIAYLADLYARWAKDHKSVDPSFDTLFGSLEDEEAAVLKDAVGASW
APRPSIITGEEKPAPAKGAKGAAAGGLAAEDSLAIARLVRAFREYGHLEAKLDPLGLKEP
TAREELDPETYGFAEKDLGRDVYIGSLLSPLLDGPSAKVSDVVDALRGVYCHSIGAEYMY
ARNHEQREWLRKRLEGDNWQSSVTVDEQKAILKNLTEAEGFETFCQKRYVGAKRFGLEGG
EISIPSLHAIIDQAAAQGVSSVTIGMAHRGRLNTLVNVVRKPYVAIFNEFAGGSFKPDDV
AGSGDVKYHLGSSTDVEVGGHSVHIALQPNPSHLEAVDPVVCGKVRAIQDDAGDTENRSG
HMGIIIHGDAAFAGQGVVYETLSMSQLKGYRTGGTIHMVVNNQVGFTTNPENGHSGIYGT
DVAKSIEAPVLHVNGDDAEAVIYVSRLAQDYRQAFASDIILDIVCYRRHGHNETDEPAFT
QPVMYKAIAAHETPHTLYSKKLVAAGVVSQDEVQAQWDAFFNKLDEDYKAAQSYKVNKAD
WLEGGWSGLIAPTTGKVEAAYPETGMALDKLRKIGAAISKVPDDFDLNSKIARQLKAKAK
MFDTGEGFDWATGEAMGFGSLLLENHRVRLSGEDCQRGTFSQRHATLIDQTNQSQYTPLN
HIQDDQAKIEIWNSFLSEYGVLGFEYGYSLRNPKTLVLWEAQFGDFANCAQVIIDQFIAS
GETKWLRMSGLVMLLPHGYEGQGPEHSSARLERYLQLCAEDNMFVCNITTPANYFHALRR
QLKLDYRKPLILMEPKSLLRHKLAVSELSDFGPGTRFQPVLGEIDALGPDADIDRVVICS
GKVYYDLLAERREKELKNVAIIRLEQLYPFPESALAEELKRYPKAQIIWCQEETENGGAW
HFADRRIEKALVAAKHQAGRPQYVGRAAAASPATGLARIYAAEQADLVERALGLKKTD
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttcagatgtgcttgtcacagcgctgaatggcgcaaatatcgcttatctggca
gatctgtatgcccggtgggcaaaagaccacaaaagcgttgatccatcctttgatacgctt
tttggttctctggaagatgaagaagccgccgttctgaaggacgccgttggcgcatcatgg
gcaccacggccttccatcatcacgggtgaggaaaagcctgctccggcaaaaggcgccaaa
ggtgctgccgctggtgggctggccgctgaagacagtctggccattgcccgtctggtgcgt
gcgttccgtgaatatggtcaccttgaagccaagctggacccgttggggctgaaagagccg
acagcacgggaagagctggacccggaaacatacggatttgctgaaaaagatctgggccgc
gacgtttatatcggttctctgctttctccgctgctggacggtccttccgccaaggtgagc
gacgttgtggacgccctgcggggggtctattgccacagcattggtgcggaatacatgtat
gcccgcaaccatgaacagcgcgaatggctgcgtaagcggcttgaaggcgataactggcaa
tccagcgtgacggtggatgagcagaaagccattctgaaaaacctgacggaagcagaaggg
tttgaaaccttctgccagaagcggtacgtgggcgccaagcgtttcgggctggaaggtgga
gaaatctccattccgtccctgcatgccattattgatcaggccgccgcgcagggtgtctcc
tcggtcaccatcgggatggcacatcgtgggcgtctgaacacgttggtgaacgtggtgcgt
aaaccctacgttgccattttcaatgaatttgccggtgggtctttcaagccggacgatgtt
gctggctctggtgacgtgaaataccatcttggctcttccactgatgtggaagtgggtggt
cattccgttcatatcgccctgcagcctaatccgtctcatcttgaagcggttgatcctgtg
gtatgcggcaaggtgcgcgccattcaggatgatgccggagatacggaaaaccggtctggc
catatggggatcatcattcacggtgatgctgcctttgccgggcagggcgtggtgtatgaa
accctctccatgtcccagcttaagggataccgcacaggcggcaccatccatatggtggtc
aacaatcaggttgggttcaccaccaaccctgaaaatggacattccggcatttatggcacg
gatgttgctaaatccattgaagccccggtgctgcatgtgaacggtgacgatgccgaggcg
gtgatttacgtctcccgtctggcgcaggattaccggcaggcttttgccagtgacatcatt
ctggatatcgtctgctatcgccgccacgggcataacgaaacggatgaacctgccttcacc
cagccggtgatgtacaaggccattgcggcacacgaaaccccgcacaccctgtattccaaa
aagctggtggctgctggggtagtttctcaggatgaagtgcaggcccagtgggatgccttc
ttcaacaagctggatgaagactacaaagccgcgcagtcctacaaggtgaacaaggcggac
tggcttgaaggtggctggtccggtctgattgcgcccaccacgggcaaggttgaagccgct
tatccggaaaccggcatggcgcttgataagctgcgtaaaattggcgctgctatctccaag
gttccggatgattttgatctgaactccaagatcgcccgtcagctcaaggccaaggccaag
atgtttgacacgggtgaagggtttgactgggcaactggtgaagcaatgggctttggctcg
ctgctgctggaaaaccatcgtgttcgtctttctggggaagactgccagcgcggcacgttc
agccagcgtcacgcaaccctgattgatcagaccaaccagtctcaatacacgccgctgaat
catattcaggatgatcaggcgaaaattgaaatctggaactccttcctttcagaatatggt
gttctgggctttgagtatgggtattccctgcgcaaccccaaaacgctggtgctgtgggaa
gcccagtttggtgattttgccaactgcgcacaggtgattatcgatcagttcattgcctcg
ggtgaaaccaagtggctgcggatgtccggtctggtcatgctgctgccgcatggatacgaa
gggcaggggccggaacattcttccgcccgtctggaacggtatttgcagctttgtgcagaa
gacaacatgtttgtctgcaatatcaccacgcctgccaattacttccatgccctgcgccgc
cagttgaagctggattaccgcaagccgttgatcctgatggagccgaaatctctgctgcgt
cacaaacttgctgtgtctgaactgtccgatttcggccccggcacgcgcttccagccggtt
ctgggtgagattgatgcgctgggcccggatgcagatattgatcgcgtggtgatctgctcg
ggcaaggtctattatgatctgctggccgaacgccgtgaaaaagaactgaaaaacgttgcc
attatccggcttgaacagctctatccgttcccggaaagcgcgctggctgaagagctgaaa
cgctacccgaaagcccagatcatctggtgccaggaagaaacggaaaatggtggggcctgg
cattttgcagaccgtcggattgaaaaggcactggttgcggcaaaacatcaggctggccgc
ccgcaatatgtgggccgtgccgcagcagccagcccggcaacggggcttgcgcgcatttat
gccgcagagcaggctgatctggttgaaagggccctgggtttgaagaaaacggactga

DBGET integrated database retrieval system