KEGG   Agrobacterium tumefaciens S33: AWN88_03360Help
Entry
AWN88_03360       CDS       T04213                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ata  Agrobacterium tumefaciens S33
Pathway
ata00473  D-Alanine metabolism
ata01100  Metabolic pathways
ata01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ata00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AWN88_03360
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AWN88_03360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ata01011]
    AWN88_03360
Enzymes [BR:ata01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AWN88_03360
Peptidoglycan biosynthesis and degradation proteins [BR:ata01011]
 Precursor biosynthesis
  Racemase
   AWN88_03360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AMD57301
UniProt: A0A120KHE2
LinkDB All DBs
Position
circular:744932..746098
Genome map
AA seq 388 aa AA seqDB search
MDMQISRQQAAGGASGHLTIDLGALRENYLALAARAPASQTAAVVKADAYGLGADMVSQT
LFDAGCRHFFVAHIDEALALRLRLPAEARIFVLNGLQPGNETSCAAMAITPVLNSLEQIA
QWAAHAKTLGRKLGAAVQIDTGMCRLGLSPEELETLTSQPQLLDGIDIAFVMSHLACADE
PGHACNAAQLSAMRQATIAFPDVPVCFSNSGGIFLGREYHNHLLRPGIALYGGAPSADRP
NPMKPVVRLDLAVIQTRTVPAGSLVGYGGSFEASGCTRLATIAAGYADGLPRSLSNRGAA
WYDGVRLPIAGRVSMDSIILDISALPEGTLTQGSFVQMIGPQQTLEDIADDAGTIAYEIL
TGLGRRYRRTYIQPDETPVFASTSVNYK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggacatgcagatcagccgccagcaggcagccggtggtgcgagcggccatctgaccatc
gatctcggcgcattgcgcgagaattatctggcacttgcggcgagggcgcccgcatcccag
acggcggcggtggtcaaggccgatgcatatggcctcggtgcggatatggtctcgcaaacc
ctgttcgatgcggggtgtcgccatttcttcgtcgctcatattgacgaggcgctggcgctc
cggctgcgtcttcccgccgaggcgcggatcttcgtcctcaacggccttcaacccggcaat
gagacctcctgcgccgccatggcgatcacaccggttctcaattcgctggagcagatcgcc
caatgggcggcccatgccaagacgctcggcaggaaacttggagccgccgtacagatcgat
accggcatgtgccgcctcggcctttcccccgaagagctggaaaccctcacttcccagccg
caactgctcgatggtatcgacatcgccttcgtcatgagccacctcgcctgcgccgacgaa
ccgggccatgcctgcaatgcggcacagctgtcggcgatgcggcaggccacgattgcgttt
cctgatgtcccggtctgtttttccaactccggaggtatttttctgggtcgtgagtaccac
aaccacctgctgcgccccggcatcgcgctttacggcggcgcaccctctgccgaccgcccg
aacccgatgaaaccggtcgttcgcctcgatctcgccgtgatccagacccgcaccgttccc
gccggttcgctggttggttacggcggttccttcgaagcgtccggctgcacgcgtctggcg
accatcgccgccggttatgcagacggcctgccgcgctcgctcagcaatcgcggcgcggca
tggtatgatggcgtgcgcctgccgattgcggggcgcgtttcgatggacagcatcattctg
gacatatccgccctgcccgagggaacattgacccaaggcagtttcgtgcagatgatcggc
ccccagcaaacgcttgaagacatcgcggacgatgcgggcacgatcgcctacgaaatcctg
accggcctcggccgtcgttatcgccgtacgtatattcagccggacgaaaccccggtcttt
gcttcaacatcagtcaattacaagtga

DBGET integrated database retrieval system