KEGG   Agrobacterium tumefaciens S33: AWN88_06500Help
Entry
AWN88_06500       CDS       T04213                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ata  Agrobacterium tumefaciens S33
Pathway
ata00564  Glycerophospholipid metabolism
ata01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ata00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AWN88_06500
Enzymes [BR:ata01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AWN88_06500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 STPPase_N Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AMD57867
UniProt: A0A0X8IWX7
LinkDB All DBs
Position
circular:complement(1444601..1446124)
Genome map
AA seq 507 aa AA seqDB search
MSDEAIHDIFVIGGGINGCGIARDAVGRGYSVALAEMNDFASGTSSAATKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPHIIWPMRFVLPFQKGGVRPAWLVRLGLFLYDHLGGRKL
LPATRSLDLRRDPAGKPLKPIFARAFEYSDGWVDDARLVVLNARDAADRGALILNRTQVV
SARRDGAFWRVETRNAAGETQVHRARMLVNAAGPWVDRVLSATFGKNNVHNVRLVQGSHI
IVRKKFSDPRAYFFQNPDGRIIFAIPYEQDFTLIGTTDRDYTGDPRAVKISDEEISYLCS
AASEYFAEPVKPSDIVWTYSGVRPLFDDGASKAQEATRDYVLKTEGTDGEAPLLNIFGGK
LTTYRRLAEHALEKIGDALGTKGAPWTAGSHLPGGNFNVEAYAAEVSTLLSRYPFLEKRH
AERLVRCYGTDVAAMIGNATDAPALGRYFGGTLYEAEVRWLMAREWALTAEDILWRRTKQ
GLFLTPDEVRGLEDYIDDIAGGRLKAI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgaggcaattcacgatattttcgtgatcggcggcggtatcaatggctgcggc
attgcgcgcgacgccgtcggcaggggctattccgtcgcacttgcagaaatgaacgatttc
gcctccggtacgtcgtctgctgcaaccaagctcattcatggcggcctgcgttatctcgaa
cattacgagtttcgcctggtgcgcgaagcgctgatggaacgcgaggttctgtgggccatg
gcgcctcatatcatctggcccatgcgtttcgtgctgcccttccagaagggcggtgtgcgt
ccggcctggctcgtgcgtctcgggctcttcctttacgatcatcttggcggccgcaagctt
ctgcccgccacccgctcgctcgatctgcgccgtgatccggccggaaagcctttgaaaccg
attttcgcccgggctttcgaatattccgatggatgggtcgatgacgcccgcctggtcgtg
ctgaacgcccgtgatgccgctgaccgtggcgcgttgatcctcaatcggacgcaggtggtt
tccgcgcggcgcgacggcgcgttctggcgggtcgagacgagaaatgccgccggagaaacg
caggtccaccgggcgcggatgttggtgaatgccgccggtccatgggtcgacagggttctg
tcggcgaccttcggcaaaaacaacgttcacaatgttcgcctcgtccagggcagccatatc
atcgtgcgcaagaagttctccgatccgcgcgcctacttctttcagaatccggatggccgc
atcattttcgccatcccttacgaacaggatttcacactgatcggcacgacggatcgcgac
tataccggtgacccccgggctgttaagattagcgacgaggaaatcagctatctctgcagc
gcggcgagtgaatattttgccgaaccggtgaagccgtccgatatcgtctggacatattcc
ggggtgcggccgctttttgatgacggcgcgtcaaaagcgcaggaggcgacgcgtgattat
gtcttgaagaccgaggggaccgacggcgaggcaccacttctcaatattttcggcggcaag
ctcaccacttatcggcgacttgccgaacatgctcttgaaaagatcggcgatgcgctggga
acaaagggagccccatggacagcgggttctcatctgccgggcggaaatttcaatgtagaa
gcttatgctgcggaggtttctacgctgctatcgcgttatcccttcctggaaaagcgtcat
gcggagcggcttgtccgctgctacggcaccgatgtggcggcgatgataggcaatgcgaca
gacgcgccggcgcttgggcggtatttcggcggcacgctctacgaagctgaagttcgctgg
ctgatggcgcgggaatgggcgctgacggcggaggatattctgtggcgccgtaccaagcag
ggcctgtttttgacccccgacgaggtgcgtgggttggaggactacatcgatgacattgca
ggtggacgattgaaggcaatctga

DBGET integrated database retrieval system