KEGG   Agrobacterium tumefaciens S33: AWN88_08575Help
Entry
AWN88_08575       CDS       T04213                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ata  Agrobacterium tumefaciens S33
Pathway
ata00564  Glycerophospholipid metabolism
ata01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ata00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AWN88_08575
Enzymes [BR:ata01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AWN88_08575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 STPPase_N Pyr_redox_2 FAD_binding_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AMD58224
UniProt: A0A0X8IX14
LinkDB All DBs
Position
circular:1908559..1910103
Genome map
AA seq 514 aa AA seqDB search
MSSENIFDLFVIGGGINGCGIARDAVGRGYSVALAEKGDFASGTSSAATKLIHGGLRYLE
HYEFRLVREALMEREILWAMAPHVIWPMRFVLPIQKGGVRPAWMVRLGLFLYDNLGGRKL
LPATRTLDLRKDPAGKPLKPAFARAFEYSDGWVDDARFVVLNARDAANRGAMIMNRTRVV
SARREGGLWLIETLDEKTGRAGVHKARMLVNAAGPWVDTVLSGVFGRKDVHNVRLVQGSH
IIVRRKFSDPRAYFFQNPDNRIIFAIPYERDFTLIGTTDRDYKGDPAKVRISEEEISYLC
NAASDYFSEPVRPEDIVWTYSGVRPLFDDGASKAQEATRDYVLKVEEGNGQAPLLNIFGG
KLTTYRRLAEHALEKIGAAIGEKGKPWTAGSHLPGGDFGAERYETQVRALVSRYPFLDRH
HAERLVRNYGTKAAELLGSVTDAVGLGRHFGGTLYECEVRWLVEQEWACTAEDILWRRTK
QGLRLNKAEAAELDDFVSKLTGGRKEAEAAVERA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgaaaacatttttgatctttttgtcatcggcggcggcatcaatggctgcggc
attgcccgcgatgcggtgggcaggggttattccgtggcgcttgcggaaaaaggcgatttc
gcttccggcacgtcgtccgccgccaccaagctcatccatggcggcctgcggtatctcgaa
cattacgagtttcgtctggtgcgcgaggcgctgatggagcgggaaattctctgggccatg
gcgccgcatgtcatctggcccatgcgtttcgtcctgcccattcagaagggcggggtgcgc
ccggcctggatggtccggcttggcctgtttctttatgacaatctcggcggccggaaactt
ttgccagccacccgaacgctcgatctgcgcaaggacccggctggaaagcctctgaagccg
gcttttgccagggccttcgaatattccgacggttgggtggatgatgcccgtttcgtggtt
ctcaatgcgcgcgatgccgctaatcgcggcgcgatgatcatgaaccgcacgcgggtcgtt
tccgcacgacgcgaaggtgggctctggctcatcgaaactctggacgaaaaaaccggccgt
gcgggcgtgcacaaggcacgtatgctggtgaacgccgctggtccctgggtggatacggtg
ctgtccggcgtcttcgggcgaaaggatgtgcataatgtccggctcgtgcagggcagccat
attatcgtgcgccggaagttttccgatccgcgcgcctatttcttccagaaccctgacaac
cgcatcatcttcgccattccctatgagcgggatttcacgctgatcggcaccacggatcgc
gactacaagggcgatccggccaaggttcgcatttccgaggaagagatttcctatctctgc
aacgccgccagcgactatttcagcgagccggttcggccggaagacatcgtctggacctat
tccggcgtgcggccgctctttgatgatggtgcttcgaaagcgcaggaagccacacgcgat
tacgtgctgaaggttgaggagggcaacgggcaagctccactcctcaatattttcggcggc
aagctcaccacctatcgacggctggcggaacatgcgctggaaaagatcggcgcggcgatc
ggcgagaagggcaaaccatggacggcgggctcacacctgccgggcggagatttcggcgcg
gagagatatgagacgcaggtgcgggcgcttgtctcccgatatcctttcctcgatagacac
catgccgagcggctagtcagaaactacggtacgaaggctgcggaattgttgggcagcgtt
accgatgccgtcgggctcggccggcatttcggcggcacgctctatgaatgcgaggtgcgc
tggctggttgagcaggaatgggcctgcacggccgaggacattctctggcgacgcacgaaa
cagggccttcgcctgaacaaggccgaggccgccgagctggatgacttcgtatccaagctg
acgggtggaaggaaagaggcggaagctgcggtggagcgagcctga

DBGET integrated database retrieval system