KEGG   Agrobacterium tumefaciens S33: AWN88_12225Help
Entry
AWN88_12225       CDS       T04213                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ata  Agrobacterium tumefaciens S33
Pathway
ata00061  Fatty acid biosynthesis
ata00780  Biotin metabolism
ata01100  Metabolic pathways
ata01212  Fatty acid metabolism
Module
ata_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ata00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AWN88_12225
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AWN88_12225
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ata01004]
    AWN88_12225
Enzymes [BR:ata01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AWN88_12225
Lipid biosynthesis proteins [BR:ata01004]
 Fatty acid synthase
  Component type
   AWN88_12225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas PS-DH
Motif
Other DBs
NCBI-ProteinID: AMD59070
UniProt: A0A109VTK8
LinkDB All DBs
Position
linear:204235..204702
Genome map
AA seq 155 aa AA seqDB search
MTEETKTTLGAADILEVMKLLPHRYPFLLIDKIIDIDGNNSATGIKNVTVNEPHFTGHFP
DRPIMPGVLIVEAMAQTAGAICARSQGEGGHLVYFMTIDNARFRKPVIPGDRLEIHVVKQ
RQRGNVFKFHCEAKVDGALVAEADVGAMMIPEDQQ
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagaaacgaagacgacgctcggcgcggctgacattctggaagtcatgaagctt
ctgccgcatcgttacccattcttgctgatcgacaagatcatcgatattgacggtaacaat
tcggcgaccggcatcaagaacgtgacggtcaacgaaccgcatttcaccggccacttcccg
gaccggccgatcatgccgggtgttctgatcgtcgaagccatggcccagacggcaggtgca
atatgcgcccgcagtcaaggtgagggcggccatctggtctacttcatgacaatcgacaac
gcccgtttccgcaaacccgtgatccccggcgatcgtctggaaatccacgtcgtcaagcag
cgccagcgcggcaatgtctttaaattccattgcgaggcgaaggtggatggtgcgctggtg
gcggaggctgatgtcggcgccatgatgatccccgaggaccagcaatga

DBGET integrated database retrieval system