KEGG   Agrobacterium tumefaciens S33: AWN88_16355Help
Entry
AWN88_16355       CDS       T04213                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ata  Agrobacterium tumefaciens S33
Pathway
ata00240  Pyrimidine metabolism
ata01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ata00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AWN88_16355
Enzymes [BR:ata01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AWN88_16355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30
Motif
Other DBs
NCBI-ProteinID: AMD61541
UniProt: A0A125RT57
LinkDB All DBs
Position
linear:1047090..1047671
Genome map
AA seq 193 aa AA seqDB search
MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTLIFTAAFDDRAGVGRVASRIGLSSDAL
TFDENTDLFAEVSALNVQAPVACVFVDEANFLSEHHVWQLAEIVDRLNIPVMSYGLRTDF
QGKLFPASKELLAIADELREIRTICHCGRKATMVARFDNEGNVVTEGAQIEVGGNEKYVS
FCRRHWVETFNGG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttcaattattcgacgatgaatgccggcaaatcgaccatgctgctg
caggcgtcctataattatcaggagcgcggcatgcgcacgctgatcttcacggccgcgttt
gacgaccgcgccggcgtcggccgtgtcgcctcgcgcatcggtctgtcctccgacgccctg
accttcgatgaaaataccgatttgttcgctgaagtatcggccctgaatgtacaggcgccc
gtcgcctgcgttttcgtcgacgaggccaatttcctctcagaacaccatgtctggcagctt
gccgagattgtcgaccggctgaacatcccggtcatgagctatggtctgcgcacggatttc
cagggcaagctcttccctgcctcgaaagaactgcttgcgattgccgacgagctgcgcgaa
atccgcaccatctgccattgcggccgcaaggcgacgatggtggcccgcttcgacaatgaa
ggaaatgtcgtcacggaaggcgcgcagattgaggtaggcggcaacgaaaaatatgtttcc
ttctgccgccgccactgggtggagacgttcaacggcggctga

DBGET integrated database retrieval system