KEGG   Agrobacterium tumefaciens S33: AWN88_20665Help
Entry
AWN88_20665       CDS       T04213                                 

Definition
(GenBank) CtpF protein
  KO
K02282  pilus assembly protein CpaE
Organism
ata  Agrobacterium tumefaciens S33
Brite
KEGG Orthology (KO) [BR:ata00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ata02044]
    AWN88_20665
   02035 Bacterial motility proteins [BR:ata02035]
    AWN88_20665
Secretion system [BR:ata02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   AWN88_20665
Bacterial motility proteins [BR:ata02035]
 Pilus system
  Pilus assembly proteins
   AWN88_20665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParA AAA_31 Fer4_NifH CBP_BcsQ Response_reg
Motif
Other DBs
NCBI-ProteinID: AMD60570
UniProt: A0A125RS85
LinkDB All DBs
Position
linear:complement(1968609..1969892)
Genome map
AA seq 427 aa AA seqDB search
MSAVEYDIKSSDGADTLQPVRTSDMDRLRPLPRISIHAFCVSDNMQGVMDALSGDRRMSK
VTLRVTKGDINAAATMFSASPTPNLIILETASAPASLLDDLAPLAEVCDPSTRVIIVGRH
NDITLYRDLIRNGISEYLVAPVNMADLLGSIAAIFVDPEAEPLGRNIAFIGAKGGVGSST
VAHNCAFGISTLFSTETILADMDLAYGTANIDFDQDPAQGMAEAVFSPERLDEVFLDRLL
TKCSDHLSLLAAPSLLDRTYDLDRQAFLPILEVLQRSAPVAVLDLPHQWCDWTRAVLAEA
DEVVITAVPDLANLRNTKNLFDALIKLRPNDKLPHLILNQVGMPKRPEIAPADFFDPLEI
EPIAIIPFEAQLFGNAANSGRMISEMDEKSQIAETFSQIAHTITGRTVLRKSRRGGLDRL
KNILKRK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgtagaatacgacatcaagtcaagcgacggagcagacaccctgcagccggtg
cgcacctccgatatggaccgcctgcggcccctgccccgcatctccatccacgccttctgc
gtcagcgacaacatgcagggcgtcatggacgcattgtccggtgacaggcgcatgagcaag
gtaacattgcgggtgacgaagggtgacatcaacgctgcggccacgatgttctctgcctcg
cctacgccaaatctcatcattctggagacggcaagcgcgccggcttcgctgctggatgac
cttgctcctctcgcggaggtttgcgatccctcaacccgtgtcatcattgtcggccgccac
aatgacataacattgtatcgcgacctcatccgcaacggtatttcggaatatctggtcgcc
ccggtcaacatggccgatcttctgggttcgatcgccgcgatcttcgtcgatcccgaagcg
gagccgcttggccgcaacatcgccttcatcggcgccaaaggtggggttgggtcctcgacg
gtcgcacataattgcgccttcggcatctcgaccctgttttcgacggaaaccattctcgcc
gacatggatctggcttatggcacagccaatatcgatttcgatcaggatccggcccagggc
atggcggaagcggttttctcgccggagcggctggatgaggtatttctcgaccgccttttg
acgaaatgctccgatcacctatcgctgctcgcggcaccgtcgcttcttgaccggacttac
gatctagaccgccaggcctttctgccgatccttgaggttttgcagcgtagcgcccccgtc
gccgtcctcgaccttccccaccaatggtgcgactggacaagggctgtgcttgcggaagcg
gatgaggtcgtcatcaccgcggttccggatcttgcgaatcttcgcaacacgaagaacctg
ttcgacgcgctgataaaactgcgccccaacgataaattgccgcatctcatcctcaaccag
gtgggcatgccgaagcgacccgaaatcgctccggcggattttttcgacccgctggaaatc
gagccgattgcgatcattccattcgaggcgcaattgtttggaaacgccgcaaacagcgga
cgcatgattagcgaaatggatgaaaaatcccagatcgcagaaaccttctcgcaaattgcc
cataccatcaccggtcgcacggtgctgcgcaaaagccggcgcggcggtctggacagactt
aagaatattctcaagcgcaagtag

DBGET integrated database retrieval system