KEGG   Agrobacterium tumefaciens S33: AWN88_23425Help
Entry
AWN88_23425       CDS       T04213                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ata  Agrobacterium tumefaciens S33
Pathway
ata00061  Fatty acid biosynthesis
ata00780  Biotin metabolism
ata01100  Metabolic pathways
ata01130  Biosynthesis of antibiotics
ata01212  Fatty acid metabolism
Module
ata_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ata00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AWN88_23425
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AWN88_23425
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AWN88_23425
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ata01004]
    AWN88_23425
Enzymes [BR:ata01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AWN88_23425
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AWN88_23425
Lipid biosynthesis proteins [BR:ata01004]
 Fatty acid synthase
  Component type
   AWN88_23425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AMD61055
UniProt: A0A0X8J2C8
LinkDB All DBs
Position
linear:complement(2529248..2530066)
Genome map
AA seq 272 aa AA seqDB search
MAQASGLMAGKRGLIMGVANNRSIAWGIAKACADAGAEVALTWQGDALKKRVEPLAQELG
AFMAGHCDVTDLETIDAVFASLEKHWGKIDFVVHAIAFSDKDELTGRYLDTSRDNFNRTM
DISVFSLAAVAKRAEPVMNDGGSIVTLTYYGAEKVMPNYNVMGVAKAALEASVRYLAVDL
GNRGIRVNAVSAGPIKTLAASGIGDFRYILKWNEYNAPLKRTVSIEEVGKSALYLLSDLS
TGVTGEIHHVDSGYHTIGMKAVDAPDISVVKD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggcatccggcctcatggctggcaaacgcggcctcatcatgggtgtcgccaat
aatcgttccatcgcttggggcatcgccaaggcctgcgccgacgcgggcgcggaagtggct
ctcacctggcagggcgatgcgctgaagaagcgtgtcgagccgctggcccaggaactcggc
gccttcatggccggtcactgcgatgtgaccgatctcgagacgatcgatgcggtttttgcc
agcctggaaaagcactggggcaagatcgacttcgtcgtgcacgccattgccttttccgac
aaggatgagctgaccggccgttacctcgataccagccgcgacaatttcaaccgcaccatg
gacatttccgtcttctcgctggccgccgttgccaagcgggcggagcccgtcatgaatgac
ggtggttcgatcgtgacgctcacctattacggcgccgaaaaggtgatgccgaactacaac
gtcatgggcgtggccaaggccgcgcttgaggcaagcgtgcgttacctcgccgtcgacctc
ggcaatcgcggcatccgcgtcaatgccgtttccgccggccctatcaagacgctcgctgct
tccggcatcggcgacttccgttacattctcaagtggaacgaatataatgcgccgctgaag
cgcaccgtttcgatcgaggaagtcggcaagtcggcgctttacctgctctccgacctttcg
accggcgtgaccggcgaaatccaccatgtcgattccggttaccacaccatcggcatgaag
gcggtggatgcgcctgacatttcggtggtgaaggactga

DBGET integrated database retrieval system