KEGG   Aethina tumida (small hive beetle): 109594573
Entry
109594573         CDS       T06105                                 

Definition
(RefSeq) uncharacterized protein LOC109594573
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:atd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109594573
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 109594573
NCBI-ProteinID: XP_019865348
LinkDB
Position
Unknown
AA seq 177 aa
MTTSVYKPIDFGLSRTVDKKMFCRPGIQRVKRALFEVDHEATKKFIKEEFEKIAVTESER
WNFDFKRERTLNPDGNLIWYPVAPQIDTRPTKRTFAPREFVNELYAQPDNIIRPKAVKLN
QTTDREDNNNLTKTPNVSQQKSIKDFLPVKRQIPTESKKTSEWTPAHPTKKIKIGDS
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaccaccagcgtgtacaaacccatcgatttcggactgtcgcggaccgtcgacaagaaa
atgttctgcaggccgggcatccagcgcgtgaagcgcgccctattcgaggtcgaccacgag
gcgaccaagaagttcatcaaggaggagttcgagaagatcgccgtcaccgagtccgagaga
tggaacttcgattttaagcgcgaacgcaccctcaatcccgacggcaacctgatctggtac
ccggtcgcgccgcaaatcgacaccagaccgacgaagaggacgttcgcgccccgcgaattc
gtcaacgaattgtacgcacaacccgacaacatcatcagaccaaaggctgtgaaactgaat
caaacaacagacagagaggacaacaacaatttgacgaaaacgccgaacgtgtcgcagcag
aaatcaatcaaagatttcttgccggtcaagagacagataccgacggagtcgaaaaagact
tcggagtggacaccggcacacccgacaaagaaaatcaaaataggagatagttaa

DBGET integrated database retrieval system