KEGG   Aethina tumida (small hive beetle): 109594574
Entry
109594574         CDS       T06105                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
atd  Aethina tumida (small hive beetle)
Pathway
atd04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:atd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109594574
SSDB
Motif
Pfam: CDI MICSWaP
Other DBs
NCBI-GeneID: 109594574
NCBI-ProteinID: XP_019865349
LinkDB
Position
Unknown
AA seq 92 aa
MVQNHQMAPHHLDQVRRRLFVDEPSEIESENQNLMPNLNNDINRLTKQMTENAKLKWNFD
FATETPLEGEWEWEKVTPEEKSPQTLNNQAKQ
NT seq 279 nt   +upstreamnt  +downstreamnt
atggtacaaaaccatcaaatggctccccaccacttggaccaggttcgtcgacgactcttc
gtagacgaaccgtcggaaatagaatcagaaaatcaaaacctgatgcctaatcttaataac
gacattaatagactgacaaagcaaatgactgaaaacgcaaagcttaaatggaacttcgat
ttcgccacggaaacgcctttggaaggcgagtgggaatgggagaaggtaacaccggaagaa
aaatcgccacaaactttaaataatcaggcgaagcagtaa

DBGET integrated database retrieval system