KEGG   Aethina tumida (small hive beetle): 109594761Help
Entry
109594761         CDS       T06105                                 

Definition
(RefSeq) calcineurin B homologous protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
atd  Aethina tumida (small hive beetle)
Brite
KEGG Orthology (KO) [BR:atd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:atd01009]
    109594761
Protein phosphatases and associated proteins [BR:atd01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     109594761
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 SPARC_Ca_bdg EF-hand_5 EF-hand_4 MMgT
Motif
Other DBs
NCBI-GeneID: 109594761
NCBI-ProteinID: XP_019865564
LinkDB All DBs
Position
Unknown
AA seq 190 aa AA seqDB search
MGNRSSLLLRQEEIAQIQQETGFTSNQIERLYSRFTALDRGDCGTLSRNDFLRIPELAIN
PLGERIVNSFFQGDEFSDRVNFRQFMQVLAHFRPIKKNKENKLNSREDKLRFAFKMYDLD
NDDLISKDELLAILHMMVGTHISEEQLTSIAERTILEADEDGDQMISFEEFCKALQRTDV
QQKMSIRFLN
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacagatcatcgcttcttttgaggcaagaagaaattgcacaaatacaacaagaa
acaggatttacttcgaaccaaattgaacgtctttactcaagatttaccgccctagacagg
ggcgattgtggcacgttaagccgaaatgattttctaagaatcccagaactagccattaat
ccattgggagagagaattgttaattcatttttccaaggagatgaatttagtgatagggtg
aactttagacagtttatgcaagttctggcacacttcaggcctattaaaaagaataaagaa
aacaaattgaactccagggaagataaattaagatttgcatttaagatgtatgatttggac
aatgatgatttaatatcaaaggatgaattattagccattttgcacatgatggttggtaca
catattagtgaagaacaattaactagcatagcagaaaggacaattttggaagctgatgaa
gacggtgatcaaatgatttcattcgaagaattttgtaaagctctacaaagaacagatgtt
caacaaaaaatgagcattcgctttttaaattaa

DBGET integrated database retrieval system